BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11007 (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 27 8.7 SB_46818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_2342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 297 SGSTSMMSCSRADTLGHSCHA-SHAP 223 S S+S S S+ DT HSCH+ S AP Sbjct: 219 SSSSSSSSSSQEDTTSHSCHSPSQAP 244 >SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 54 YYTRLTLDFDTNKRICEEIAIIPTKPLRNK 143 YY++LT D+D+ K EI I+P+ P+ K Sbjct: 14 YYSKLTHDYDSGKLQSPEI-ILPSVPVVTK 42 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +3 Query: 102 EEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRDNYV 251 + + +P++ LRN++ + L R + Q I K +EE+ + NY+ Sbjct: 456 KNLQAMPSEGLRNQLTLMSVALQRSIFTIQHDHIKAKKREEQEQMAQNYL 505 >SB_46818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 76 ILIQIKEYVKKSLSFLPSLLGIKLLDL 156 +L I+E K L+ LPSL+ +K LDL Sbjct: 219 LLAWIQEKRKNGLAILPSLIRMKALDL 245 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,102,285 Number of Sequences: 59808 Number of extensions: 196569 Number of successful extensions: 431 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -