BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11006 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 25 3.2 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 24 4.2 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 24.6 bits (51), Expect = 3.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 397 YANVVKIKHEFKNKLLNMKIECHIFEVKLL*ARYTRQIV 513 + VV +FK+ L + E FE+K L ARYT ++ Sbjct: 88 FPTVVAAGKQFKDYLEDAIDEQEEFELKELLARYTTDVI 126 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 24.2 bits (50), Expect = 4.2 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 24 IYTNIHTYIQYILIY 68 +YTN+H Y+ +I +Y Sbjct: 388 VYTNVHHYLPWIKMY 402 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,568 Number of Sequences: 2352 Number of extensions: 13099 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -