BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11004X (527 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 25 0.54 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 3.8 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 6.7 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 24.6 bits (51), Expect = 0.54 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 343 YVTGYTMLMYDTIFVP*INGSYLRPL 266 YV+GY + D +P + YLRPL Sbjct: 16 YVSGYLENIRDRRVLPTVEPGYLRPL 41 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.8 bits (44), Expect = 3.8 Identities = 4/12 (33%), Positives = 10/12 (83%) Frame = -1 Query: 338 YWLYHAYVRYYL 303 YWL+H ++ +++ Sbjct: 599 YWLFHCHIEFHV 610 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.0 bits (42), Expect = 6.7 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -3 Query: 462 RCNCTP*FIYKSFYFESCFCKTRRSQSGS*VFTEVN 355 RC C P F K + CK ++G ++N Sbjct: 53 RCQCQPGFTGKYCHENINDCKVNPCENGGTCVDKIN 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,882 Number of Sequences: 336 Number of extensions: 2540 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -