BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV11004X (527 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132948-33|CAD57708.2| 734|Caenorhabditis elegans Hypothetical... 28 4.8 AL132948-32|CAD31833.3| 731|Caenorhabditis elegans Hypothetical... 28 4.8 >AL132948-33|CAD57708.2| 734|Caenorhabditis elegans Hypothetical protein Y39B6A.43b protein. Length = 734 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/42 (26%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 284 FVPTSSAKDPIRKTEFDNQSY-LISLTAMHSVTGSYIHKFTI 162 FVP +++ +R+ ++ +SY +++T+M + +Y F I Sbjct: 396 FVPPVTSRQTVRRPNWEKKSYEKVNMTSMPQMVSAYYEGFNI 437 >AL132948-32|CAD31833.3| 731|Caenorhabditis elegans Hypothetical protein Y39B6A.43a protein. Length = 731 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/42 (26%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 284 FVPTSSAKDPIRKTEFDNQSY-LISLTAMHSVTGSYIHKFTI 162 FVP +++ +R+ ++ +SY +++T+M + +Y F I Sbjct: 393 FVPPVTSRQTVRRPNWEKKSYEKVNMTSMPQMVSAYYEGFNI 434 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,439,684 Number of Sequences: 27780 Number of extensions: 224994 Number of successful extensions: 423 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -