BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10999 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.58 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.4 bits (53), Expect = 0.58 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 649 TTHLSQQLWIRSH-HCSALCFTNQS*QCDSEVTTP 548 +T S+Q R HC ALC CD E+T P Sbjct: 728 STARSEQFLCRYEAHCFALCHCCDFDACDCEMTCP 762 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.4 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 699 PYNSLRSTLNLNKILYTQHIYPNNYGSDPTTVQHYALQISL 577 P SL ST ++ + P YG + T +HYAL ++ Sbjct: 740 PRASLVSTTSVKSLRLEGDETPP-YGMELTEAEHYALYTAM 779 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,678 Number of Sequences: 438 Number of extensions: 4151 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -