BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10998 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 3.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.5 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 358 RDPTLHLKETLEQHLGHPELESFTEEKEYCEEIL 459 R+ H+ E +Q L LE+F E+ EE+L Sbjct: 16 RNQLQHVLEETQQALELINLENFFPEENVVEELL 49 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 132 PNAPHPPRDTSERHAGEYSRQPHD 61 P AP+ P + E AG +P D Sbjct: 48 PAAPNMPAEEGEGMAGVTGEEPFD 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,592 Number of Sequences: 438 Number of extensions: 3034 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -