BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10997 (788 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 25 0.69 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 24 1.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.8 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.8 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 6.4 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 8.5 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 316 TRALRPQIVRPSKPRTASSASVDLRIQQMR 227 T ++RP ++ SKPR A + V+ RI+Q + Sbjct: 97 TGSIRPGVIGGSKPRVA-TPEVENRIEQYK 125 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 527 PLSLTLSFPFEGTFYV 574 PL+L L FP++G F V Sbjct: 208 PLNLGLDFPYQGKFEV 223 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 202 THSSVDHNMKRHLQVQVY*HYSPNLQHK 119 T S +H+M H+Q Q H+ P+ Q + Sbjct: 159 TQSMNNHHMGHHMQEQHPQHHQPHHQQQ 186 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 202 THSSVDHNMKRHLQVQVY*HYSPNLQHK 119 T S +H+M H+Q Q H+ P+ Q + Sbjct: 161 TQSMNNHHMGHHMQEQHPQHHQPHHQQQ 188 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 624 SNSISWNL*TATVIENAT*NVPSNGNES 541 SN + L + + + T NVPSNG S Sbjct: 57 SNGLVTTLASGSSLNGLTNNVPSNGLSS 84 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -3 Query: 306 YDRKSSVHPNHVLRLQHPWIFEFNKCE 226 ++ ++ +P+H ++LQH +FN E Sbjct: 97 HELETKFNPHHEIKLQHLHQSKFNPHE 123 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,603 Number of Sequences: 336 Number of extensions: 3277 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -