BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10995 (382 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125767-1|BAC86280.1| 168|Homo sapiens protein ( Homo sapiens ... 29 3.8 BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation... 28 8.7 >AK125767-1|BAC86280.1| 168|Homo sapiens protein ( Homo sapiens cDNA FLJ43779 fis, clone TESTI2051488. ). Length = 168 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/83 (27%), Positives = 26/83 (31%) Frame = +3 Query: 27 HGASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFSGRQH 206 H + C R R CC+ H S GSR S G C R H Sbjct: 82 HTSRRCGGSSRSRECCSSLH-----SSRGSRGSSWSSSPPGSTCRWCSCHSHHHSHHRSH 136 Query: 207 CVTVDCCCHGSPHAMRDAKHHPF 275 + C H S H HH F Sbjct: 137 HRSHHCSHHHSHHHSGHHSHHNF 159 >BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation factor 1 protein. Length = 483 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 57 RGRRCCNIWHWGSVD-SISGSRARF-QLSGNSGRKHSRC 167 RGR +W WGS + G RA +L NSG K C Sbjct: 411 RGRGTGRLWRWGSKERRACGVRAMLPRLVSNSGLKRPSC 449 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,347,968 Number of Sequences: 237096 Number of extensions: 1084358 Number of successful extensions: 2068 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2063 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2526356360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -