BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10993 (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 29 2.0 SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) 29 3.5 SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) 29 3.5 SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) 28 4.7 SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) 28 6.2 SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) 28 6.2 SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 42.3 bits (95), Expect = 3e-04 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +2 Query: 170 MIPHKTERGKNALRRLRTYDGCPPPF 247 MIPHKT++G A+ R++ +DG PPP+ Sbjct: 1 MIPHKTKKGTEAMNRMKVFDGVPPPY 26 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = +1 Query: 301 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVAYEKKLKRITKDAGEKVSKA 474 PG C VG+L H W + R L R+ + ++ A + + +G+ S++ Sbjct: 866 PGEQLCLVGQLGHRARWSSSVIDRPLHTGRRRDSARKAAAGGRTADQGERSGDSASRS 923 >SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +2 Query: 335 PMKLDGNTVMLFVSLKTRGRARLL--RELPMKRNLRGSPRMLVRR 463 P K +GNT V ++ GR + L R +P++ N G P+ LV+R Sbjct: 1114 PGKAEGNTDKRIVPVENNGRIKQLDKRIIPVENN--GRPKQLVKR 1156 >SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) Length = 622 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 301 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVA 417 PG C VG+L H W + R L R+ + ++ A Sbjct: 407 PGEQLCLVGQLGHRARWSSSVIDRPLHTGRRRDSARKAA 445 >SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) Length = 271 Score = 28.7 bits (61), Expect = 3.5 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +1 Query: 292 CLKPGRNYCHVGRL---SHEIGWKYRDVVRKL--EDKRKGKAVKRVAYEKKLKRITKDAG 456 C KPG+++ HV + H ++ D R + + K A+K +Y KLK + +D G Sbjct: 106 CYKPGQDFLHVVHVLNRPHIFSSRHHDAYRAIIHDVNEKANALKD-SYISKLKALVQDEG 164 >SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 621 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 153 HRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTT 10 H + AL+W+G R FTL + + + LS + K + + C ++T Sbjct: 530 HEVWYQALRWRGERVYFTLIMPWMSRVPLSQPIPKRSDRVSCGALSST 577 >SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43) Length = 443 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 349 WKYR-DVVRKLEDKRKGKAVKRVAYEKKLKRITKDAGEKVSKATTP 483 W+ R V++ E K+K + + +A KK+K+ K + + SK + P Sbjct: 378 WRLRAGVLQAAEMKKKRQKAQSLAERKKIKKEKKKSNPRRSKCSVP 423 >SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) Length = 225 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -2 Query: 114 RAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTTTL 4 R G+ + + ++ ++ LFL PE++ R TT + Sbjct: 131 RGGYNCSVCKTSEAAMELFLNNQPEVIFIDMRDTTPI 167 >SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/80 (26%), Positives = 35/80 (43%) Frame = +2 Query: 8 VVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKT 187 VVV+ + I +SG + NKL H + ++ILW+ V GM+P K Sbjct: 57 VVVINTKHIVLSGTKWDNKLYRHHTGYPGGLKEILAKDLHRKDGTRILWRAVNGMLP-KN 115 Query: 188 ERGKNALRRLRTYDGCPPPF 247 ++RL ++ P+ Sbjct: 116 NLRPTWMKRLYLFEDEHHPY 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,558,367 Number of Sequences: 59808 Number of extensions: 378245 Number of successful extensions: 1692 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1691 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -