BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10991 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_02_0028 - 8736882-8737540,8737686-8738268 28 6.8 >04_02_0028 - 8736882-8737540,8737686-8738268 Length = 413 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/58 (22%), Positives = 26/58 (44%) Frame = -2 Query: 489 GISHNCLLNTIRRLKYTVPKCNLKCISLQATKVIEDTA*IKFELQIQYDIFNLRHTLN 316 G +CL N ++R+ ++ C ++ K +T + LQ+ + N R +N Sbjct: 340 GCGFDCLQNHLKRVVLQFQMEDVNCFGVRLAKFFAETCKVLDVLQVDDGVHNFRRHIN 397 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,763,038 Number of Sequences: 37544 Number of extensions: 349637 Number of successful extensions: 582 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -