BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10991 (742 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011188-1|AAR88549.1| 1034|Drosophila melanogaster RE06749p pro... 32 0.94 AF002164-1|AAC14585.1| 1034|Drosophila melanogaster AP-3 delta-a... 32 0.94 AE014298-1950|AAF48307.2| 1034|Drosophila melanogaster CG10986-P... 32 0.94 >BT011188-1|AAR88549.1| 1034|Drosophila melanogaster RE06749p protein. Length = 1034 Score = 31.9 bits (69), Expect = 0.94 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -2 Query: 618 DSQEVLTPVKSRDHAKRPSQRKD*KKPRPTSSVCFILSFD*Y---IGIS 481 ++ EV + V + H K SQRK+ KK ++SV I+S Y +GIS Sbjct: 979 EASEVASKVHKKKHKKEKSQRKEKKKASESASVSAIVSIGDYEQPLGIS 1027 >AF002164-1|AAC14585.1| 1034|Drosophila melanogaster AP-3 delta-adaptin subunit protein. Length = 1034 Score = 31.9 bits (69), Expect = 0.94 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -2 Query: 618 DSQEVLTPVKSRDHAKRPSQRKD*KKPRPTSSVCFILSFD*Y---IGIS 481 ++ EV + V + H K SQRK+ KK ++SV I+S Y +GIS Sbjct: 979 EASEVASKVHKKKHKKEKSQRKEKKKASESASVSAIVSIGDYEQPLGIS 1027 >AE014298-1950|AAF48307.2| 1034|Drosophila melanogaster CG10986-PB protein. Length = 1034 Score = 31.9 bits (69), Expect = 0.94 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -2 Query: 618 DSQEVLTPVKSRDHAKRPSQRKD*KKPRPTSSVCFILSFD*Y---IGIS 481 ++ EV + V + H K SQRK+ KK ++SV I+S Y +GIS Sbjct: 979 EASEVASKVHKKKHKKEKSQRKEKKKASESASVSAIVSIGDYEQPLGIS 1027 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,684,666 Number of Sequences: 53049 Number of extensions: 606328 Number of successful extensions: 1048 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -