BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10990 (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0493 - 18046553-18046990,18047061-18047180,18047290-180474... 27 8.7 02_05_0683 + 30877731-30878243 27 8.7 >09_04_0493 - 18046553-18046990,18047061-18047180,18047290-18047478, 18047596-18047739,18048673-18048900,18049659-18049838, 18050304-18050399,18051096-18051262,18051356-18051773, 18052335-18052517,18053846-18053953,18054053-18054246, 18054503-18054662 Length = 874 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +2 Query: 269 LLRSKDNNIKIKISFTFNIFALNVNAVIISHIIKC--IVPIFSYLTCRLKLMKIIYFY 436 L+++KD + IK T + L N I + +I+C ++P + L LM FY Sbjct: 621 LVKAKDTHKAIKTFMTIRSYGLPANVAIYNIMIECCKLLPCVKSASAVLSLMLRDGFY 678 >02_05_0683 + 30877731-30878243 Length = 170 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 94 GAMSGGKTSCESARVGTTALPISA 23 GA GG T+ +AR T A+P++A Sbjct: 129 GASDGGSTAAMAARGSTVAVPVAA 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,150,171 Number of Sequences: 37544 Number of extensions: 194062 Number of successful extensions: 377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -