BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10989 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08010.1 68418.m00932 expressed protein condensin subunit SMC... 27 9.8 At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF... 27 9.8 At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive eff... 27 9.8 >At5g08010.1 68418.m00932 expressed protein condensin subunit SMC4, Drosophila melanogaster, EMBL:AF186472 Length = 566 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 220 SGTKGRRPVCVACDGISVGLVSA 288 +GT PV V C GIS+G++S+ Sbjct: 206 NGTGSNDPVLVLCVGISIGIMSS 228 >At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 295 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -1 Query: 353 IGRCGRRAQRHARTHIH-KYKLGADTSPTLIPSHATHTGRLPFVPLQLNFSYIVKLTEY 180 +G G+R + + + H + LG SP L+P T + L+L FS T+Y Sbjct: 47 VGETGQRVDKQSNSATHLAFSLGDVKSPRLVPKPHGATFSMQSPCLELGFSQPPIYTKY 105 >At1g65780.1 68414.m07465 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 1065 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 52 LDLHFSSVCDKLNTVIVS 105 LDLHFSS+C L T ++S Sbjct: 442 LDLHFSSLCTHLPTALLS 459 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,413,413 Number of Sequences: 28952 Number of extensions: 245779 Number of successful extensions: 554 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -