BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10987 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 27 0.49 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.85 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 27 0.85 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 0.85 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 27 0.85 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 24 4.5 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.5 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 24 6.0 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 27.5 bits (58), Expect = 0.49 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 336 SGRASVSC*PPTCPGTGACIQSQTGHISFPGTALLQILEE 217 +GR +V C PP PG AC + I+ T IL E Sbjct: 31 NGRQNVGCNPPGIPGGPACAGLKPMVITINSTLQTLILSE 70 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.85 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 82 VSDACKTTYEEIKKDKKHRYVVFYIRD 162 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.6 bits (56), Expect = 0.85 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 82 VSDACKTTYEEIKKDKKHRYVVFYIRD 162 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHPHPIIYLRD 121 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 0.85 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 82 VSDACKTTYEEIKKDKKHRYVVFYIRD 162 + AC +E+I + KH + + Y+RD Sbjct: 47 ILSACSPYFEQIFVENKHPHPIIYLRD 73 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.6 bits (56), Expect = 0.85 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 82 VSDACKTTYEEIKKDKKHRYVVFYIRD 162 + AC +E+I + KH + + Y+RD Sbjct: 95 ILSACSPYFEQIFVENKHLHPIIYLRD 121 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 351 DTAKVKKKMLYSSSFDALK 407 DTAKV +K+ YSS+F L+ Sbjct: 257 DTAKVFQKIFYSSAFSKLR 275 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 534 VASSCVNAVIGDRWRGASLRRPPETLPRGRS 442 V +S + A +G AS R+PP LPR S Sbjct: 183 VLNSLLAAKVGGGQPSASPRQPPTPLPRRSS 213 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +3 Query: 423 VQKYIQATDLSEASQEAVEEKLR 491 ++KY++ DLSE +E ++ +L+ Sbjct: 896 IEKYLKPLDLSEKQKEEMKSQLK 918 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 440 LDVLLNSDKGLFQSVERARVQH 375 +D+L +D G F VE R+ H Sbjct: 361 MDILERNDNGYFLFVEGGRIDH 382 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,418 Number of Sequences: 2352 Number of extensions: 14794 Number of successful extensions: 81 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -