BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10978 (350 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 1.2 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 2.8 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 4.8 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 4.8 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 4.8 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 4.8 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.6 bits (46), Expect = 1.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 132 QKMKVNLRNHYKNKKYKPL 188 +K ++ N Y N KYKPL Sbjct: 24 KKTVFDIPNDYLNDKYKPL 42 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 2.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 158 PLQKQEIQAFRFKSQGDPCYAQGSY*TRSKDQ 253 P + +AF+ K DP +GSY R D+ Sbjct: 348 PQNAKTQKAFQVKRVPDPSKRKGSYIFRLPDE 379 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 20.6 bits (41), Expect = 4.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 128 SPEDEGQS*KPLQKQEI 178 SP +G KP+ K+EI Sbjct: 464 SPNVDGPDWKPISKEEI 480 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 20.6 bits (41), Expect = 4.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 128 SPEDEGQS*KPLQKQEI 178 SP +G KP+ K+EI Sbjct: 464 SPNVDGPDWKPISKEEI 480 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 20.6 bits (41), Expect = 4.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 128 SPEDEGQS*KPLQKQEI 178 SP +G KP+ K+EI Sbjct: 466 SPNVDGPDWKPISKEEI 482 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 20.6 bits (41), Expect = 4.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 66 ASKLSKIRVVRKAIARVYIVYH 131 + KLSKI+ ++ A + +YH Sbjct: 128 SDKLSKIQTLKLAARYIDFLYH 149 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,931 Number of Sequences: 336 Number of extensions: 1040 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6981810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -