BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10978 (350 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 3.3 AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 23 3.3 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 23 4.4 AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding pr... 22 7.6 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 22 7.6 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 3.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 274 LSDLFPRLIFASCLVRALRIARVSLALK 191 LSD+ + + L+R +R+A+V L+ Sbjct: 1703 LSDIIEKYFVSPTLLRVVRVAKVGRVLR 1730 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +2 Query: 77 VQDPCCKKSYRTCLHCVSPEDEGQS*KPLQKQEIQAFRFKSQGDPCY 217 VQD CK+ Y+ C + + + ++KQ R K++ D Y Sbjct: 52 VQDDKCKRKYKCCND--ANTENMEKIHEIKKQCFMEVRNKNKADGAY 96 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 100 FLTTRILDSFEATPPVTLATRRFVNSV 20 +L I +S PPV + RRF +V Sbjct: 60 YLELVIKESLRLYPPVPIIARRFTENV 86 >AY330182-1|AAQ16288.1| 181|Anopheles gambiae odorant-binding protein AgamOBP56 protein. Length = 181 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 77 VQDPCCKKSYRTC 115 VQD CK+ Y+ C Sbjct: 24 VQDDKCKRKYKCC 36 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 304 GIDSRWEERFLSDLFPRLIFASCLVRA 224 G+ S + + LFP ++ A LVRA Sbjct: 274 GVKSSGKASYFLALFPYVVMAVLLVRA 300 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 268,520 Number of Sequences: 2352 Number of extensions: 4060 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 25364985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -