BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10971 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 142 9e-35 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 32 0.19 SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.75 SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.99 SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 30 0.99 SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_24409| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) 29 1.7 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 28 3.0 SB_57515| Best HMM Match : CBFNT (HMM E-Value=3.3) 28 3.0 SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) 28 3.0 SB_38682| Best HMM Match : DAGAT (HMM E-Value=1.4e-16) 28 4.0 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_19001| Best HMM Match : MBOAT (HMM E-Value=2.2) 27 5.3 SB_12442| Best HMM Match : zf-MYND (HMM E-Value=0.0028) 27 5.3 SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) 27 5.3 SB_50343| Best HMM Match : MAP (HMM E-Value=3.4) 27 5.3 SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) 27 5.3 SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_867| Best HMM Match : Leo1 (HMM E-Value=0) 27 5.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 27 7.0 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 27 9.2 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 27 9.2 SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) 27 9.2 SB_19150| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_1096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_28072| Best HMM Match : VWA (HMM E-Value=0) 27 9.2 SB_614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 142 bits (345), Expect = 9e-35 Identities = 64/84 (76%), Positives = 74/84 (88%) Frame = +1 Query: 1 VDGGLNVPHSIKRFPGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKY 180 VDGGL +PHS+KRFPGYD+ESK F+AEVHR HIFG HVAEYMRSL ++DE+S+KRQFS Y Sbjct: 199 VDGGLEIPHSMKRFPGYDSESKDFSAEVHRNHIFGKHVAEYMRSLAEEDEESYKRQFSAY 258 Query: 181 IKLGVTADAIEAIYKKAHEAIRAD 252 IK GV AD+IE IYK AH+AIRAD Sbjct: 259 IKNGVDADSIEGIYKAAHQAIRAD 282 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/39 (48%), Positives = 32/39 (82%) Frame = +3 Query: 258 HKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 374 HKK E KKD V+ KR++++K++ +R +R+KQKKA+F++ Sbjct: 285 HKKAE-KKD-VQLKRFHRKKMSRQQRVDRVKQKKAAFLR 321 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = +2 Query: 191 ESLQMLLKPSTRKPMKPSVRILPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 358 E++++ + R+ + RIL +EERVK + +A E + +G +E+Q + KE Sbjct: 187 EAVRIAQEEMRREREEEENRILEEEERVKREEEEKKAKEVEEKRMGEDEEQIKLKE 242 >SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1097 Score = 31.9 bits (69), Expect = 0.24 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 212 KPSTRKPMKPS-VRILPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 358 KP KPS V+ LP+ VK+ ++ + E+ +A G EE++ + KE Sbjct: 606 KPPPAPAKKPSKVKHLPKLAAVKKEKDKSSSSEEERAKSGEEEREEEEKE 655 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 30.3 bits (65), Expect = 0.75 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 243 PCGSSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 395 P + KKK+ KK K+K+ K+K ++K + K+KK K+ + + E Sbjct: 144 PQPPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEE 194 Score = 30.3 bits (65), Expect = 0.75 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 243 PCGSSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 395 P KKK+ KK K+K+ K+K ++K + K+KK K+ + + E Sbjct: 146 PPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEEE 196 Score = 30.3 bits (65), Expect = 0.75 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 243 PCGSSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 395 P KKK+ KK K+K+ K+K ++K + K+KK K + + E Sbjct: 147 PTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEEEE 197 >SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.9 bits (64), Expect = 0.99 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 228 SP*SHPCGSSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 359 +P + G KKK+ KK K+K+ NK+K+ E K ++++ Sbjct: 104 APLAGVAGLKKKKKKKKKKKKKKKKINKKKINKVEEKEEGEEEE 147 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 29.9 bits (64), Expect = 0.99 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +1 Query: 52 DAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIK 186 D+ K+ NAE+ RA +++ ++S D+E + R+F + K Sbjct: 157 DSSVKRGNAEIRRARFRATTISQVVQSFRSDEERNSVRKFIAHYK 201 >SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 252 SSHKKKELKKDSVKQKRWNKRK-LTLAERKNRIKQKKA 362 +S KKELK D+ K+ NKRK + +E K KKA Sbjct: 130 TSESKKELKSDTKSVKKANKRKTMNESESTKTKKPKKA 167 >SB_24409| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-14) Length = 439 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -2 Query: 258 GRIRTDGFMGFLVDGFNSICSDS*FYVLAELSLERILIILFKTSH 124 GR R D F+ F V GF + S LA +S+ER++ + F H Sbjct: 192 GRFRFDAFVVF-VSGFEYFSTFSSVNFLAAVSVERLVAVAFPFYH 235 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 1.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 261 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 377 +KK+ +K K+K+ K+K +KN+ K KK +K+ Sbjct: 19 RKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKK 57 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 261 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 359 KKK+ KK K+ + NK+ ++K ++K+KK Sbjct: 27 KKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKK 59 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 261 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 395 +KK KK K+K+ K+K +KN+ + K K+++ + E Sbjct: 16 EKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKE 60 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 29.1 bits (62), Expect = 1.7 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +2 Query: 248 RILPQEERVKERLGQTEALEQTQANI---GREEKQNQAKE 358 ++ QEE + E+ GQ + LEQT+ + G +KQ +KE Sbjct: 2246 KVQDQEEELDEQAGQIQILEQTKLRLEMAGERDKQLISKE 2285 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 252 SSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 359 + H+ K K++SVK KR KRK +RK++ K K Sbjct: 217 AKHRLKR-KRESVKHKRKQKRKSAKHKRKHKRKSDK 251 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 258 HKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 359 HK K+ K++ K++R + K +ERK ++KK Sbjct: 191 HKDKKKKREESKERRRHSDKAEKSERKREKEEKK 224 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 276 KKDSVKQKRWNKRKLTLAERKNRIKQK 356 +KD + RW+KR +L + K R+K+K Sbjct: 709 EKDLSLRSRWSKRVHSLIDEKTRVKEK 735 >SB_57515| Best HMM Match : CBFNT (HMM E-Value=3.3) Length = 213 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 236 KPSVRILPQEERVKERLGQTEALEQTQANI--GREEKQNQAKEGF 364 K I +EE+ E + EA E+T A + G+E+KQ + + F Sbjct: 162 KEKTEIAVEEEKEGEEFKREEAAEETPAEVADGKEKKQRRRRFSF 206 >SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) Length = 599 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 261 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAEA 398 +KKE KK+ K+++ K+K ERK K+++ K+ E+ Sbjct: 48 RKKERKKERKKERKKEKKKERKKERKEERKKERKKAEKKFTDSNES 93 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +3 Query: 261 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 383 +KKE KK+ K+++ ++K ERK K+++ K+ + Sbjct: 44 RKKERKKERKKERKKERKKEKKKERKKERKEERKKERKKAE 84 >SB_38682| Best HMM Match : DAGAT (HMM E-Value=1.4e-16) Length = 807 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +3 Query: 219 LQESP*SHPCGSSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 377 + E P HP S + K+ K ++ K + K+T + R K + F+K+ Sbjct: 158 IAEEPHKHPYASKDRGKKCDKIALNLKENHGFKVTQRSVRKRFKSLREDFLKK 210 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 8/37 (21%) Frame = -1 Query: 355 FCLILFFLSAN--------VSLRLFQRFCLTESFFNS 269 FCL +FF+S + S+RLF+ FC+T S F S Sbjct: 242 FCLSIFFISKDKKEEVLHFFSIRLFKVFCVTLSGFTS 278 >SB_19001| Best HMM Match : MBOAT (HMM E-Value=2.2) Length = 596 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 240 HPCGSSHKKKELKKDSVKQKRWNKRKLTLAERK 338 H CGS+H + LK ++ KR RKLT R+ Sbjct: 5 HRCGSAHPRIVLKTTAI--KRQQPRKLTETSRR 35 >SB_12442| Best HMM Match : zf-MYND (HMM E-Value=0.0028) Length = 3809 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +2 Query: 227 KPMK-PSVRILPQEERVKERLGQTEALEQTQANIGREEKQNQAK 355 KP+K PS +I P+EE V + ++E E+ I EE ++AK Sbjct: 1648 KPVKQPSEQIEPEEEPVTQTSEESEPEEEPMTQI-PEESMSEAK 1690 >SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) Length = 332 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 264 KKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 395 K + K+D+VK+++ + RKL K R +Q+K I++ +A E Sbjct: 106 KPDCKQDAVKEQKPSGRKLKRKLYKQRKRQEKFKKIEKKKAIRE 149 >SB_50343| Best HMM Match : MAP (HMM E-Value=3.4) Length = 243 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 255 SHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 377 S K+++KK S+K++ KR + K R KK S KR Sbjct: 202 STNKRDIKKTSIKKRSMKKRSIKKRSMKKR-SIKKRSIKKR 241 >SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) Length = 465 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Frame = +3 Query: 156 FQETIQQVHKTRSHC---RCY*SHLQ----ESP*SHPCGSSHKKKELKKDSV 290 + +T+ Q KTR HC RC S ++ E+P P G K+E+++ +V Sbjct: 188 YTDTLHQKSKTRMHCTAARCEGSLMRPYGGENPSPRPYGIPRPKEEVREHAV 239 >SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +3 Query: 264 KKELKKD---SVKQKRWNKRKLTLAERKNRIKQKK 359 KK++KK+ +K+K+ +K+K+ ++K + K+KK Sbjct: 10 KKQIKKEEIIKIKKKKKSKKKIKKKKKKKKKKKKK 44 >SB_867| Best HMM Match : Leo1 (HMM E-Value=0) Length = 591 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 254 LPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 358 L +E ++ + E+ E+TQA + REE + + +E Sbjct: 276 LSSDEEKEDNAREVESKEETQARVPREEGEEEEEE 310 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +3 Query: 252 SSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKA 362 + H+ +E+KK ++R KR+ LAE+K R +QK A Sbjct: 597 AKHQNEEIKKKKEAEER--KRR-ALAEQKERDRQKSA 630 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +2 Query: 224 RKPMKPSVRILPQEERVKERLGQTEALEQTQANIGREEKQNQAKEGFLHQETA 382 R P KPS R + E+ +E + + Q G E + KEG + E A Sbjct: 891 RSPPKPSQRTDAESEKRREYVNSLLIKSEPQVARGHLELERVGKEGGVTSEAA 943 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 258 HKKKELKKDSVKQKRWNKRKLTLAE 332 H+K+ELKK K+K K++ T+ E Sbjct: 555 HQKQELKKQRFKEKMEKKQEETMVE 579 >SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) Length = 581 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 136 EQDDEDSFKRQFSKYIKLGVTADAI 210 +QD+ F QF K +KLG+ D++ Sbjct: 361 DQDNYKKFYEQFGKNLKLGIHEDSV 385 >SB_19150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 329 REEKQNQAKEGFLHQETAGSGG--SLNALNIIFE 424 R +N +K F HQE G+G S AL ++FE Sbjct: 378 RPGNENLSKAYFWHQEAPGNGSIESQGALGVMFE 411 >SB_1096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 257 PQEERVKERLGQTEALEQTQANIGREEKQNQAKEGFLHQE 376 PQE+ +K +L + L + G EE+ N+ + H++ Sbjct: 50 PQEKSMKNQLNEIRYLRWLLMSKGTEERLNEVRSDIRHEK 89 >SB_28072| Best HMM Match : VWA (HMM E-Value=0) Length = 2979 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 121 YMRSLEQDDEDSFKRQFSKYIKLGVT 198 Y+R + QD+ED F +YI+ G++ Sbjct: 911 YLRPVVQDEEDLFVFSLFRYIRRGIS 936 >SB_614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 26.6 bits (56), Expect = 9.2 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 5/74 (6%) Frame = +2 Query: 212 KPSTRKPMKPSVRILPQEERVKERL---GQTEALEQTQANIGREE-KQNQAKEGFLHQET 379 K + +P+KP + P+E+ E L G + ++ + ++ +Q Q ++G + Sbjct: 339 KKTPEEPVKPEEPVKPEEQEEPEELEEQGDSNSVFVPMVDPTEQDCRQEQEEQGDSNSVP 398 Query: 380 AGSGGSLNA-LNII 418 GG N LNII Sbjct: 399 LAPGGQFNQDLNII 412 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,761,441 Number of Sequences: 59808 Number of extensions: 211396 Number of successful extensions: 1059 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -