BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10960 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38975| Best HMM Match : Serpin (HMM E-Value=0) 46 3e-05 SB_55237| Best HMM Match : Serpin (HMM E-Value=0) 42 4e-04 SB_55238| Best HMM Match : Serpin (HMM E-Value=0) 37 0.016 SB_5257| Best HMM Match : SlyX (HMM E-Value=2.2) 30 1.8 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 3.1 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 29 4.1 SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) 28 7.2 SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) 27 9.5 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_49672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_38975| Best HMM Match : Serpin (HMM E-Value=0) Length = 380 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/89 (24%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +3 Query: 255 KAIGFPDDDAIRTEFASKSRDLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNSDV 434 K FP D + ++ + + G ++ MAN+++ G ++ E F S++ F++++ Sbjct: 58 KTFHFPTDVPEKFHDFLQALNASNSDGNQILMANRLFAQMGFEILEEFKKASKESFSAEM 117 Query: 435 QNIDFSKNTVAAK-SINDWVEENTNNALR 518 +D+ KN+ A+ ++N WVE+ T + ++ Sbjct: 118 ALVDYVKNSNGARDTVNRWVEQKTKDKIK 146 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 494 RKYQ*RIKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLT 622 +K + +IK+L+ + T LVNA+YFKG+W F+ T Sbjct: 139 QKTKDKIKNLIPEGMFNKDTILCLVNAVYFKGSWMKHFNRNAT 181 >SB_55237| Best HMM Match : Serpin (HMM E-Value=0) Length = 363 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/61 (29%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +3 Query: 339 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWVEENTNNAL 515 E+++ NK++ HD ++ E F +R+ ++S++ +DF +K A K +N WV + T + Sbjct: 54 EIQLVNKIWGHDEFEILEEFLHGTREFYHSEMAQVDFVNKAFDARKEVNAWVHQQTKGNI 113 Query: 516 R 518 + Sbjct: 114 K 114 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLT 622 IK+L+ ++S T ++VNA+YFKG W +F E T Sbjct: 113 IKELIPHGVINSLTRLIIVNAVYFKGVWKKEFGEENT 149 >SB_55238| Best HMM Match : Serpin (HMM E-Value=0) Length = 345 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 509 RIKDLVNPDSLSSATAAVLVNAIYFKGAWSSKF 607 +I DL+ P + T LVNAIYFKG W F Sbjct: 107 KICDLIAPGVFNMLTRLTLVNAIYFKGMWDKPF 139 Score = 35.1 bits (77), Expect = 0.047 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 339 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDFSKNTVAA-KSINDWVEENTNNAL 515 E+ +AN +++ + + F + + +++D+ +D+ + A K +N WVEE T + Sbjct: 49 EMSIANNLFLQKDFSILKEFTDICQKYYDADISLVDYKTDFEGARKHVNQWVEERTKKKI 108 >SB_5257| Best HMM Match : SlyX (HMM E-Value=2.2) Length = 641 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 3/93 (3%) Frame = +3 Query: 249 AFKAIGFPDDDAIRTEFASKSRDLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNS 428 AF F DD + E S+++D +++ K + K +E+ + S +F+ Sbjct: 420 AFPRFYFLSDDEL-LEILSQTKDPTAVQPHLRKCFENIAKL---KFEEDLRISS--MFSG 473 Query: 429 DVQNIDFSKNTVAAKSINDW---VEENTNNALR 518 + +N+DFS + ++ DW VE N+LR Sbjct: 474 EGENVDFSTDLYPTGNVEDWLLEVENTMRNSLR 506 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 391 RILQSFPGTSSIRTSKTLISRRIQSQLS 474 R+ SFPG S TL++R QSQ+S Sbjct: 65 RLYDSFPGASRSEAESTLLARMRQSQVS 92 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +1 Query: 67 AMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDG 234 +MAAV + +L+ + + + ++KNN +S+ AF+ L L L L+S+G Sbjct: 36 SMAAVCRPAGLLEPDHFALPVAVESLILKNNSIRSIAKGAFNGLDKLLTLDLSSNG 91 >SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 28.7 bits (61), Expect = 4.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 75 CHCRDGDSKQTNDCL 31 CHCRDG+S Q N+ + Sbjct: 336 CHCRDGESVQVNNAM 350 >SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) Length = 672 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRFSL 161 HQ L + E + ++PK PR +F L Sbjct: 56 HQNLSINEMDSSSPKRPRQHQFGL 79 >SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRFSL 161 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRFSL 161 HQ L + E + ++PK PR +F L Sbjct: 50 HQNLSINEMDSSSPKRPRQHQFGL 73 >SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRFSL 161 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRFSL 161 HQ L + E + ++PK PR +F L Sbjct: 7 HQNLSINEMDSSSPKCPRQHQFGL 30 >SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) Length = 1541 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 374 WWKTRREFCSRFQGRLQFGRPK 439 W + RRE+C++ Q R ++ +P+ Sbjct: 1275 WLRWRREYCTQLQSRQKWNKPQ 1296 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 193 VLPPLAQLALASDGETHEELLKLSASLTTMLYEQNSRV 306 +LPPLA L +++G T L++ + +++ +Y NS V Sbjct: 993 ILPPLASLVSSTNGNTRMLCLRMFSDVSS-IYLDNSNV 1029 >SB_49672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 232 HQKLKLTEREEAAPKMPRGQRF 167 H+ L + ER+ ++PK PR +F Sbjct: 21 HENLSINERDSSSPKRPRQHQF 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,219,425 Number of Sequences: 59808 Number of extensions: 356418 Number of successful extensions: 1193 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1193 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -