BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10960 (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 46 3e-05 At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 46 3e-05 At1g63280.1 68414.m07154 serpin-related / serine protease inhibi... 43 1e-04 At1g51330.1 68414.m05772 serpin-related / serine protease inhibi... 43 2e-04 At1g47710.1 68414.m05302 serpin, putative / serine protease inhi... 42 3e-04 At2g14540.1 68415.m01628 serpin family protein / serine protease... 41 8e-04 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 40 0.001 At1g64030.1 68414.m07252 serpin family protein / serine protease... 38 0.004 At1g62170.1 68414.m07013 serpin family protein / serine protease... 38 0.007 At2g35580.1 68415.m04357 serpin family protein / serine protease... 34 0.068 At1g33390.1 68414.m04133 helicase domain-containing protein simi... 30 1.1 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 1.5 At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containi... 29 1.9 At5g37490.1 68418.m04515 U-box domain-containing protein similar... 29 3.4 At1g51980.1 68414.m05863 mitochondrial processing peptidase alph... 29 3.4 At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, ... 28 4.4 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 28 5.9 At5g58870.1 68418.m07376 FtsH protease, putative contains simila... 27 7.8 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/39 (48%), Positives = 30/39 (76%), Gaps = 2/39 (5%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLV--NAIYFKGAWSSKFDERLT 622 IK++++ DS+ + ++L+ NA+YFKGAWS KFD +LT Sbjct: 150 IKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLT 188 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +2 Query: 512 IKDLVNPDSLSS--ATAAVLVNAIYFKGAWSSKFDERLT 622 IK +++ DS+ + ++ VL NA+YFKGAWSSKFD +T Sbjct: 85 IKQILSRDSIDTIRSSTLVLANAVYFKGAWSSKFDANMT 123 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 336 VELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWVEENTNNA 512 + L +AN V++ L +F + + + + +DF SK + +N W E +TN Sbjct: 25 LRLSIANGVWIDKFFSLKLSFKDLLENSYKATCSQVDFASKPSEVIDEVNTWAEVHTNGL 84 Query: 513 LR 518 ++ Sbjct: 85 IK 86 >At1g63280.1 68414.m07154 serpin-related / serine protease inhibitor-related similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885346 Length = 120 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSD 628 I DL+ S+ S T V NA+YFKGAW +KFD+ T D Sbjct: 28 IIDLLPRGSVKSETVQVYGNALYFKGAWENKFDKSSTKD 66 >At1g51330.1 68414.m05772 serpin-related / serine protease inhibitor-related similar to serpin [Hordeum vulgare subsp. vulgare] CAA64599.1 GI:1197577 Length = 193 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/37 (45%), Positives = 27/37 (72%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLT 622 IK+L+ P S+++ T + NA+YFKGAW +KF + +T Sbjct: 51 IKNLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMT 87 >At1g47710.1 68414.m05302 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 391 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSD 628 I +++ S S T + NA+YFKG W+ KFDE LT + Sbjct: 150 ITEVLPEGSADSMTKLIFANALYFKGTWNEKFDESLTQE 188 >At2g14540.1 68415.m01628 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 407 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSD 628 IK+++ S++S T + NA+YFKGAW FD+ +T D Sbjct: 179 IKEILPRGSVTSLTNWIYGNALYFKGAWEKAFDKSMTRD 217 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 39.9 bits (89), Expect = 0.001 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 560 VLVNAIYFKGAWSSKFDERLTSD 628 +L NA+YFK AWS KFD +LT D Sbjct: 168 ILANAVYFKAAWSRKFDAKLTKD 190 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSD 628 IKDL+ S++S T + NA+ FKGAW F++ T D Sbjct: 151 IKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRD 189 Score = 34.3 bits (75), Expect = 0.068 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +3 Query: 315 DLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWV 491 D + G ++ AN +++ D F + + F + +DF S+ K +N WV Sbjct: 84 DRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWV 143 Query: 492 EENTNNALR 518 E +TNN ++ Sbjct: 144 EHHTNNLIK 152 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 512 IKDLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLT 622 IKDL+ S++S T V +A+YFKG W K+ + +T Sbjct: 215 IKDLLPRGSVTSLTDRVYGSALYFKGTWEEKYSKSMT 251 >At2g35580.1 68415.m04357 serpin family protein / serine protease inhibitor family protein similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885350; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 374 Score = 34.3 bits (75), Expect = 0.068 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 527 NPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSD 628 NP S + T + NA++F G W S+FD LT D Sbjct: 157 NPKS-APLTDHIFANALFFNGRWDSQFDPSLTKD 189 >At1g33390.1 68414.m04133 helicase domain-containing protein similar to kurz protein [Drosophila melanogaster] GI:5869803; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1237 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = +1 Query: 142 EVVKN--NPGKSVVLSAFSVLPPLAQLALASDGETHEELLKLSASL 273 E VKN +PGK VL +++L P AQL + + E E L+ ++ ++ Sbjct: 636 EQVKNKFSPGKLRVLPLYAMLSPAAQLRVFEEVEKEERLVVVATNV 681 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 183 REDNAFPWIIFHYFGKHSGCEVIVSIFEYIREICDG 76 R D +++F KHS CE+ VS E ++ G Sbjct: 2 RSDTVLDYVVFELSPKHSKCELFVSSNEQTEKLASG 37 >At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 613 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 180 EDNAFPWIIFHYFGKHSGCEVIVSIFEYIRE 88 +D F ++ +GKH CE + IFE +RE Sbjct: 434 KDPVFWNVMISGYGKHGECESAIEIFELLRE 464 >At5g37490.1 68418.m04515 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 207 ERRQHRKCREDNAFPWIIFHYFGKHSGCEVIVSIFEYI 94 E ++RKC +N+ W++ F K SG E + + I Sbjct: 153 ESEKNRKCVNENSVGWVLCDCFDKFSGDEKLTFMLNEI 190 >At1g51980.1 68414.m05863 mitochondrial processing peptidase alpha subunit, putative similar to mitochondrial processing peptidase alpha subunit, mitochondrial precursor, Alpha-MPP (Ubiquinol-cytochrome C reductase subunit II) [Potato] SWISS-PROT:P29677 Length = 503 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 208 AQLALASDGETHEELLKLSASLTTML 285 A++ LA+ G HEELLK++ LT+ L Sbjct: 256 ARMVLAASGVEHEELLKVAEPLTSDL 281 >At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, putative similar to pathogen-inducible alpha-dioxygenase [Nicotiana attenuata] GI:12539609; contains Pfam profile PF03098: Animal haem peroxidase Length = 639 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +3 Query: 387 DENFAVVSRDVFNSDVQNIDFSKNTVAAKSINDWVEENTNNALRI*LIRTRSAQPQRLFS 566 DE V DV++ DV+ +D +A K I + T + + ++ TR + R F+ Sbjct: 516 DEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFL-IMATRRLEADRFFT 574 Query: 567 S 569 S Sbjct: 575 S 575 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 3 HSRDAGHKHEDNHLFVYYRHRGNGSRHKS 89 H D H H+ NH ++ H G+ H S Sbjct: 312 HDHDHDHHHDHNHDHDHHHHDGHDHHHHS 340 >At5g58870.1 68418.m07376 FtsH protease, putative contains similarity to cell division protein FtsH homolog 3 SP:P73437 (EC 3.4.24.-) [strain PCC6803] {Synechocystis sp.} Length = 806 Score = 27.5 bits (58), Expect = 7.8 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = +1 Query: 136 FTEVVKNNPGKSVVLSAFSVLPPLAQLALASDGETHEELLKLSASLTTMLYEQNSRVKAV 315 F V N+ + V + F VL L + ET +KLS S TML + K V Sbjct: 181 FLSKVNNDEVQKVEVDGFHVLFKLKDDGNLQESETSSSSIKLSESSETML-RSVAPTKRV 239 Query: 316 IFDQLKALSLK 348 ++ + +K Sbjct: 240 VYSTTRPRDIK 250 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,832,474 Number of Sequences: 28952 Number of extensions: 251938 Number of successful extensions: 903 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -