BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10959X (422 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106,981... 32 0.22 04_03_0985 - 21438036-21438116,21438373-21438495,21438903-214389... 30 0.67 09_02_0338 + 7426999-7428322,7428390-7428646 28 3.6 05_03_0634 + 16432679-16433076,16433358-16433610,16433993-164342... 28 3.6 05_03_0618 - 16262826-16263097,16263111-16263183 27 4.7 09_04_0269 + 16265191-16265472,16265574-16266149 27 6.2 03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 27 8.2 >01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106, 9817922-9818191,9818330-9818369,9818519-9818616, 9818745-9818825 Length = 349 Score = 31.9 bits (69), Expect = 0.22 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 171 SRARVQLSGNSGRKHSRCCTS-ILRKFSGGSIVSQLTAAAMVAPTP*GD 314 S++ V LS +GRK R C+ ++R SI + LT+AA+V P P GD Sbjct: 137 SQSIVSLSSFAGRKRIRVCSGFVIRWNDSTSIGTILTSAALVRP-PCGD 184 >04_03_0985 - 21438036-21438116,21438373-21438495,21438903-21438995, 21439176-21439388,21439589-21439687,21440248-21440317, 21442549-21442619,21442817-21442954,21443034-21443132, 21444061-21444144,21444268-21444324,21444594-21444683, 21444886-21445026,21445778-21445882,21445962-21446114, 21446215-21446316,21446404-21446562,21447039-21447222, 21447336-21447418,21447523-21447588,21447736-21447793, 21447903-21448003,21448269-21448355,21449063-21449185, 21449285-21449364,21449857-21450066,21450159-21450270, 21450709-21450927,21451356-21451726,21451866-21451965, 21452544-21452752,21453232-21453337,21453435-21453767 Length = 1439 Score = 30.3 bits (65), Expect = 0.67 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 147 GSVDSISGSRARVQLSGNSGRKHSRCCTSI-LRKFSGGSIVSQLT 278 GS DS+ G + R+ + N K C T I LRK SG + +S +T Sbjct: 668 GSKDSLVGYQVRLDSARNERTKLLFCTTGILLRKLSGNNDLSDVT 712 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 3.6 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -2 Query: 166 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 26 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >05_03_0634 + 16432679-16433076,16433358-16433610,16433993-16434291, 16434553-16434729,16435001-16435621,16435690-16435784, 16436000-16436088,16436185-16436250,16436475-16437026, 16437879-16437953,16438305-16438375,16438456-16438513, 16441506-16442048 Length = 1098 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 156 DSISGSRARVQLSGNSGRKHSRCCTSILRKFSGGSIVSQLTAAAMVA 296 D + +R R + G + K RCC +ILRK S G S + A+++ Sbjct: 127 DISNKARERSRAYGAAVTKIERCCPNILRKRSRGDGSSNERSTALLS 173 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 4.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 51 RIARREQKLKEHGASSCISGKRGRRC 128 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 163 MESTDPQCHILQHRRPRLPL 104 M T P C +L++ RPRLPL Sbjct: 157 MARTGPLCLLLENPRPRLPL 176 >03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 Length = 353 Score = 26.6 bits (56), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 57 ARREQKLKEHG-ASSCISGKRGRRCCNIWHWGSVDSISG 170 A RE + ++G A + G R N W G DS+SG Sbjct: 44 ALRESSVSQNGMAPPEPTAHEGHRASNSWSSGDTDSVSG 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,210,404 Number of Sequences: 37544 Number of extensions: 219397 Number of successful extensions: 540 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -