BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10958X (315 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 1.4 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 1.8 SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 27 2.4 SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 27 3.2 SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) 26 5.6 SB_7486| Best HMM Match : Frizzled (HMM E-Value=0) 26 5.6 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 26 7.4 SB_47009| Best HMM Match : WSC (HMM E-Value=0.16) 26 7.4 SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_17378| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 1.4 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 130 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 249 C ++H G+++ I + R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 142 WHWGSVDSISGSRARFQLSGNSGRKHSR 225 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 142 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILR 246 + W VDSI+ S+A+F S + H T LR Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR 299 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 27.1 bits (57), Expect = 3.2 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 182 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 57 +REP S PQ H+L +R L + ++ CS CS+ I Sbjct: 57 SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99 >SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) Length = 439 Score = 26.2 bits (55), Expect = 5.6 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 307 RGGYHGSITSTVT--QCCRP*ISVVCLCSSGCASCR 206 R Y G+ T+ +CC P C CSSG SCR Sbjct: 141 RAPYTGTQCDTIKCPECCPP---ETCDCSSGHQSCR 173 >SB_7486| Best HMM Match : Frizzled (HMM E-Value=0) Length = 535 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 314 LMAWGLPWQHHVNCDTMLPAXNFRSM 237 L +G+PW + +NC L N R+M Sbjct: 117 LTEFGIPWPNPLNCTRFLVRNNERNM 142 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 25.8 bits (54), Expect = 7.4 Identities = 10/36 (27%), Positives = 24/36 (66%) Frame = +1 Query: 175 SRARFQLSGNSGRKHSRCCTSILRKFXAGSIVSQLT 282 +++ FQ++G +G++ + C ++R+F + SQL+ Sbjct: 129 AKSFFQVNGKNGQEET--CEDLVREFEGNGLFSQLS 162 >SB_47009| Best HMM Match : WSC (HMM E-Value=0.16) Length = 852 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 206 LFPLS*NRAREPLMESTDPQCHILQH---RRPRLPLMQLEAPC 87 L +S N ME + Q ++ H R PRLP+ + PC Sbjct: 580 LIRISYNNPAHTKMEERNDQNPVILHQFPRNPRLPVPNISPPC 622 >SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 25.8 bits (54), Expect = 7.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 133 CNIWHWGSVDSISGSRARF 189 C + HWGSV + + RAR+ Sbjct: 35 CQVPHWGSVRTFNVCRARY 53 >SB_17378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 25.4 bits (53), Expect = 9.8 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 154 SVDSISGSRARFQLSGNSGRKHSRCCTSILRKFXAGSI 267 S+ SI RARF + + CTS++ +F A + Sbjct: 34 SLFSIDALRARFSGNALAASSKEEDCTSVIGRFNANGV 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,883,547 Number of Sequences: 59808 Number of extensions: 166101 Number of successful extensions: 319 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -