BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10958X (315 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 24 1.2 AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 24 1.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 2.7 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 3.6 AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 22 4.7 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 22 4.7 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 22 6.2 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 22 6.2 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 22 6.2 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 22 6.2 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 21 8.2 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 21 8.2 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 128 RRPRLPLMQLEAPCSFNFCSLRAIRRYKCYYVD*GSL 18 +R L+ L C+ C ++A R ++CYY + G+L Sbjct: 105 KRTERCLVNLPQECNGEPC-VQAYRAFQCYYQNYGTL 140 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 128 RRPRLPLMQLEAPCSFNFCSLRAIRRYKCYYVD*GSL 18 +R L+ L C+ C ++A R ++CYY + G+L Sbjct: 105 KRTERCLVYLPQECNGEPC-VQAYRAFQCYYQNYGTL 140 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 183 STGATNGVNRPP 148 STG++N NRPP Sbjct: 1627 STGSSNSCNRPP 1638 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 3.6 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +1 Query: 130 CCNIWHWGSVDS 165 CC +W W ++S Sbjct: 88 CCRLWRWPDLNS 99 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 74 CSLRAIRRYKCYY 36 CSL A Y+CYY Sbjct: 245 CSLAARSLYECYY 257 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 74 CSLRAIRRYKCYY 36 CSL A Y+CYY Sbjct: 245 CSLAARSLYECYY 257 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 242 SMLVQQRLCFLPLFPLS*NRAREPLMESTDPQCHILQHR 126 SMLV + P PLS ++++ P ++ H L H+ Sbjct: 38 SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 104 QLEAPCSFNFCSLRAIRRYKCYYVD*GSL 18 +L+ P + RA ++CYY G+L Sbjct: 133 RLDRPAPHDEACERAYESFRCYYEHYGNL 161 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 104 QLEAPCSFNFCSLRAIRRYKCYYVD*GSL 18 +L+ P + RA ++CYY G+L Sbjct: 117 RLDRPAPHDEACERAYESFRCYYEHYGNL 145 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 104 QLEAPCSFNFCSLRAIRRYKCYYVD*GSL 18 +L+ P + RA ++CYY G+L Sbjct: 133 RLDRPAPHDEACERAYESFRCYYEHYGNL 161 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 92 HCHMDVVRRQLTMKNHSATHALN 114 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 92 HCHMDVVRRQLTMKNHSATHALN 114 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 93 HCHMDVVRRQLTMKNHSATHALN 115 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 92 HCHMDVVRRQLTMKNHSATHALN 114 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 92 HCHMDVVRRQLTMKNHSATHALN 114 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 76 HCHMDVVRRQLTMKNHSATHALN 98 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 43 HLYLRIARREQKLKEHGASSCIS 111 H ++ + RR+ +K H A+ ++ Sbjct: 106 HCHMDVVRRQLTMKNHSATHALN 128 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 131 HRRPRLPLMQLEAPCSFNFCSLRAIRRY 48 HRR R Q+ A C + C+L ++ Y Sbjct: 127 HRRVR---RQVVAECCYQSCTLDTLKSY 151 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 294,434 Number of Sequences: 2352 Number of extensions: 5067 Number of successful extensions: 58 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20748816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -