BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10958X (315 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB126079-1|BAD20206.1| 202|Homo sapiens keratin associated prot... 31 0.94 BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation... 29 2.9 AJ628245-1|CAF31637.1| 177|Homo sapiens keratin associated prot... 28 6.6 AB126071-1|BAD20198.1| 177|Homo sapiens keratin associated prot... 28 6.6 BC000952-1|AAH00952.1| 477|Homo sapiens hypothetical protein FL... 27 8.8 AL109810-4|CAI19162.1| 230|Homo sapiens tripartite motif-contai... 27 8.8 >AB126079-1|BAD20206.1| 202|Homo sapiens keratin associated protein protein. Length = 202 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 307 RGGYHGSITSTVTQCCRP*ISVVCLCSSGCASC 209 +GG GS + CC+P C CSSGC SC Sbjct: 131 KGGC-GSCGCSQCNCCKP-----CCCSSGCGSC 157 >BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation factor 1 protein. Length = 483 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 70 EQKLKEHGASSCISGKRGRRCCNIWHWGSVD-SISGSRARF-QLSGNSGRKHSRC 228 E++ EH S RGR +W WGS + G RA +L NSG K C Sbjct: 396 EERWAEHTGDSP-RPLRGRGTGRLWRWGSKERRACGVRAMLPRLVSNSGLKRPSC 449 >AJ628245-1|CAF31637.1| 177|Homo sapiens keratin associated protein 5-8 protein. Length = 177 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 307 RGGYHGSITSTVTQCCRP*ISVVCLCSSGCAS 212 +GG GS + + CC+P C CSSGC S Sbjct: 105 KGGC-GSCGCSQSSCCKP-----CCCSSGCGS 130 >AB126071-1|BAD20198.1| 177|Homo sapiens keratin associated protein protein. Length = 177 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 307 RGGYHGSITSTVTQCCRP*ISVVCLCSSGCAS 212 +GG GS + + CC+P C CSSGC S Sbjct: 105 KGGC-GSCGCSQSSCCKP-----CCCSSGCGS 130 >BC000952-1|AAH00952.1| 477|Homo sapiens hypothetical protein FLJ20628 protein. Length = 477 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +1 Query: 109 SGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFXAGSIV 270 SG +GR C H GS D S+A+ + C TS R F AG ++ Sbjct: 106 SGDQGR--CGPTHQGSEDPSMLSQAQSAIEVEERHVSPSCSTSRERPFQAGELI 157 >AL109810-4|CAI19162.1| 230|Homo sapiens tripartite motif-containing 67 protein. Length = 230 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -2 Query: 176 EPLMESTDPQCHILQHRRPRLPLMQLEAPCSFN 78 EPL+++ Q +Q + P +PL+QLE C+ N Sbjct: 61 EPLLQAIH-QLDFIQMKLPPVPLLQLEKCCTRN 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,431,882 Number of Sequences: 237096 Number of extensions: 693799 Number of successful extensions: 1503 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1503 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1453211950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -