BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10954 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 28 0.21 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 27 0.48 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 26 1.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 3.4 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.9 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGIFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 28.3 bits (60), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRLTRRW 44 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 27.1 bits (57), Expect = 0.48 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 ARPQTEATCGTSHTSLRIPWTSCCWGPPTAFPRSW 593 ARPQT CG +I CW PP R W Sbjct: 11 ARPQTPEDCGMFKFQRKILLIFGCW-PPDRRTRRW 44 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 92 CRPWTSAMPETKPCLPLSLYGHCTNG-ILY 6 C+P PET+ C + G+C +G I+Y Sbjct: 89 CKPTYVYHPETQQCYQMYTRGYCPSGKIIY 118 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 432 LSDGRRLRLPRDVRGKG 482 L+DGRR+R+ +V GKG Sbjct: 2207 LTDGRRVRVTVEVFGKG 2223 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 429 LLSDGRRLRLPRDVRG 476 +LSDGR L DVRG Sbjct: 2497 MLSDGRYLEFEYDVRG 2512 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 429 LLSDGRRLRLPRDVRG 476 +LSDGR L DVRG Sbjct: 2498 MLSDGRYLEFEYDVRG 2513 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,690 Number of Sequences: 2352 Number of extensions: 12603 Number of successful extensions: 72 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -