BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10954 (617 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 4.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 4.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 4.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 4.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 4.2 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 7.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 7.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 7.3 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 7.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 7.3 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 7.3 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.3 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.3 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.3 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.3 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 7.3 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 7.3 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 7.3 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 7.3 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 7.3 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 7.3 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 7.3 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 7.3 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 7.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 7.3 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 7.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 7.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 7.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.6 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 558 CWGPPTAFPRSWTKSASR 611 C GPPT FPR +A R Sbjct: 150 CIGPPTPFPRFIPPNAYR 167 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +1 Query: 424 VLCYQT--DGASACLVM-SEAKAKELGLKPKLPAGLHIRRSGSRG 549 V CY D +A ++ SE A GLKP + +R +RG Sbjct: 458 VRCYPRYDDATNATVIQTSELSATFKGLKPSTDYAIQVRAKTTRG 502 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT+FPR +A R Sbjct: 379 GPPTSFPRFIPPNAYR 394 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT+FPR +A R Sbjct: 379 GPPTSFPRFIPPNAYR 394 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT+FPR +A R Sbjct: 379 GPPTSFPRFIPPNAYR 394 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT+FPR +A R Sbjct: 379 GPPTSFPRFIPPNAYR 394 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT+FPR +A R Sbjct: 368 GPPTSFPRFIPPNAYR 383 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 150 GPPTPFPRFIPPNAYR 165 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 150 GPPTPFPRFIPPNAYR 165 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 150 GPPTPFPRFIPPNAYR 165 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 156 GPPTPFPRFIPPNAYR 171 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 151 GPPTPFPRFIPPNAYR 166 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 151 GPPTPFPRFIPPNAYR 166 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 146 GPPTPFPRFIPPNAYR 161 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 146 GPPTPFPRFIPPNAYR 161 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 146 GPPTPFPRFIPPNAYR 161 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 146 GPPTPFPRFIPPNAYR 161 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 157 GPPTPFPRFIPPNAYR 172 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 157 GPPTPFPRFIPPNAYR 172 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 160 GPPTPFPRFIPPNAYR 175 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 150 GPPTPFPRFIPPNAYR 165 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 155 GPPTPFPRFIPPNAYR 170 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 155 GPPTPFPRFIPPNAYR 170 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 155 GPPTPFPRFIPPNAYR 170 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 152 GPPTPFPRFIPPNAYR 167 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 162 GPPTPFPRFIPPNAYR 177 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 371 GPPTPFPRFIPPNAYR 386 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 377 GPPTPFPRFIPPNAYR 392 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 377 GPPTPFPRFIPPNAYR 392 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 397 GPPTPFPRFIPPNAYR 412 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 367 GPPTPFPRFIPPNAYR 382 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 378 GPPTPFPRFIPPNAYR 393 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 378 GPPTPFPRFIPPNAYR 393 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 367 GPPTPFPRFIPPNAYR 382 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 385 GPPTPFPRFIPPNAYR 400 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 389 GPPTPFPRFIPPNAYR 404 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 564 GPPTAFPRSWTKSASR 611 GPPT FPR +A R Sbjct: 399 GPPTPFPRFIPPNAYR 414 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 564 GPPTAFPR 587 GPPT FPR Sbjct: 371 GPPTPFPR 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,175 Number of Sequences: 438 Number of extensions: 3528 Number of successful extensions: 44 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -