BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10953 (622 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25040.1 68416.m03129 ER lumen protein retaining receptor, pu... 27 7.6 At1g20400.1 68414.m02544 myosin heavy chain-related 27 7.6 >At3g25040.1 68416.m03129 ER lumen protein retaining receptor, putative / HDEL receptor, putative similar to SP|P35402 ER lumen protein retaining receptor (HDEL receptor) {Arabidopsis thaliana}; contains Pfam profile PF00810: ER lumen protein retaining receptor Length = 215 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 303 TFRHWFL-LPLICFIKLVGTKFSTNNVSLFNQQ*YSETI 416 TFRHWFL LP L+ KF+ V L+ Y E + Sbjct: 94 TFRHWFLVLPCFLLALLIHEKFTFLEV-LWTSSLYLEAV 131 >At1g20400.1 68414.m02544 myosin heavy chain-related Length = 944 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 501 NRCKNLRIKQCRGRARRLTSRFIII 427 N C N RIKQ RG RR +++ Sbjct: 23 NGCVNARIKQVRGATRRCRFELVVL 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,484,415 Number of Sequences: 28952 Number of extensions: 200131 Number of successful extensions: 330 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -