BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10931 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 26 0.31 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.7 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 328 FIILSICNSYLNIISKKKH 272 F+ L IC+SYL I K+K+ Sbjct: 16 FLFLLICDSYLKIYHKEKY 34 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 223 VIIILDDELPGFLFINCVFF*KLYLNTNYIL 315 V++ L PGF +C F + + N +L Sbjct: 655 VVLRLRANNPGFWLFHCHFLFHIVIGMNLVL 685 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,076 Number of Sequences: 336 Number of extensions: 2853 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -