BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10931 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0134 - 14071190-14071435,14071800-14071988,14072114-140721... 27 9.7 >12_02_0134 - 14071190-14071435,14071800-14071988,14072114-14072194, 14072261-14072404,14072528-14072761,14072836-14073981, 14074863-14074922,14075178-14075420,14075509-14075607, 14076196-14076367,14076597-14076735,14077514-14077624, 14077695-14077797,14077885-14077962,14078054-14078122, 14078203-14078275,14078891-14078975,14079473-14079536, 14079963-14080073,14080139-14080213,14080306-14080398, 14080982-14081056,14081172-14081261 Length = 1259 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 340 ILEYFIILSICNSYLNIISKKKHNL*IKNRAIHHLVL 230 + + F +LS+C SYLN SK+ N + H LV+ Sbjct: 618 VSDMFSLLSLCGSYLNKESKQNSNQKCRLSNPHALVV 654 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,968,786 Number of Sequences: 37544 Number of extensions: 241367 Number of successful extensions: 251 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 251 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -