BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10931 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32100.1 68415.m03924 ovate protein-related contains TIGRFAM ... 27 8.1 >At2g32100.1 68415.m03924 ovate protein-related contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 244 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -1 Query: 558 LPDIYWRIIILFFLIERTNCFKDNNIKATSA--DGVVKP 448 +P I W+ + L F T C+ I +SA DG+++P Sbjct: 1 MPKILWKSLHLCFPSNLTKCYSSPCIPPSSADPDGIIQP 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,964,146 Number of Sequences: 28952 Number of extensions: 218206 Number of successful extensions: 265 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -