Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10912
         (735 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1ZPU6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.5  

>UniRef50_Q1ZPU6 Cluster: Putative uncharacterized protein; n=1;
           Vibrio angustum S14|Rep: Putative uncharacterized
           protein - Vibrio angustum S14
          Length = 353

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 120 AVILHSYSYRILG--FSCKRMKPKISEVFNFFF*IYLCIWYRFSSVIPLHRLLNRNSVNE 293
           A  +H Y Y  L   F C  +   +  V N+   + +     +SSV  L  LLNR+S+N 
Sbjct: 146 ACFVHDYPYEALFNLFVCIVLSTSLCSVVNYSNSVAIRKLILYSSVDMLTGLLNRSSLNN 205

Query: 294 IIT*INNNRHIL 329
           +   IN+N H L
Sbjct: 206 V---INSNNHTL 214


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 715,683,876
Number of Sequences: 1657284
Number of extensions: 14327091
Number of successful extensions: 28197
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 27312
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28194
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59677054775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)