BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10912 (735 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0111 - 12440818-12441129,12441242-12441585,12441663-124419... 30 1.7 02_04_0137 + 20137615-20138223 29 3.8 >09_03_0111 - 12440818-12441129,12441242-12441585,12441663-12441989, 12443444-12443602,12443687-12443784,12444745-12444821 Length = 438 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 600 TNLIL*ESSTKLVG*LYKCISRLVLFGKVSCNHIWLDNNFT 722 T L + S + + L+ C S +L G V ++I LDNNF+ Sbjct: 250 TRLRIAHESAEALAYLHSCASPPILHGDVKSSNILLDNNFS 290 >02_04_0137 + 20137615-20138223 Length = 202 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 110 GLSNFTRTGVRAQSGGKEFANSCSSTSGGD 21 GL++ R +R SGG+ +S SS + GD Sbjct: 66 GLNSIVRCALRCSSGGRMMMSSSSSAAAGD 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,776,287 Number of Sequences: 37544 Number of extensions: 367179 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -