BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10912 (735 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA... 24 9.4 >AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA protein. Length = 1087 Score = 24.2 bits (50), Expect(2) = 9.4 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -3 Query: 346 FFYISINMCLLL 311 FFYI++N+CL + Sbjct: 274 FFYITVNLCLFI 285 Score = 22.6 bits (46), Expect(2) = 9.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 337 ISINMCLLLFI*VIISLTLLRFRSLCNGMTLEKRYQIHK 221 ++ N +L + + SLT LR R L + + L+ +HK Sbjct: 308 LNFNCAWVLVLMLRHSLTYLRGRGLSSYLPLDHHVYLHK 346 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,042,966 Number of Sequences: 53049 Number of extensions: 654179 Number of successful extensions: 1271 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3314233461 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -