SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10912
         (735 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA...    24   9.4  

>AE013599-2248|AAF58016.1| 1087|Drosophila melanogaster CG3896-PA
           protein.
          Length = 1087

 Score = 24.2 bits (50), Expect(2) = 9.4
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -3

Query: 346 FFYISINMCLLL 311
           FFYI++N+CL +
Sbjct: 274 FFYITVNLCLFI 285



 Score = 22.6 bits (46), Expect(2) = 9.4
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = -3

Query: 337 ISINMCLLLFI*VIISLTLLRFRSLCNGMTLEKRYQIHK 221
           ++ N   +L + +  SLT LR R L + + L+    +HK
Sbjct: 308 LNFNCAWVLVLMLRHSLTYLRGRGLSSYLPLDHHVYLHK 346


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,042,966
Number of Sequences: 53049
Number of extensions: 654179
Number of successful extensions: 1271
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1271
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3314233461
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -