BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10905 (729 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr... 27 2.7 SPAC22E12.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 2.7 >SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr 3|||Manual Length = 1516 Score = 27.1 bits (57), Expect = 2.7 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -1 Query: 396 NSKNSKEI-AEQMIGSIPTSGIKWLSGRLILFAS 298 +SKN I A ++G P+S +KWL+ R I AS Sbjct: 366 DSKNENLINATSLLGVDPSSLVKWLTKRKIKMAS 399 >SPAC22E12.12 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 96 Score = 27.1 bits (57), Expect = 2.7 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 190 HGHLAPNKESVCYRNPRLIY 249 HG L PN E++ YR+ R+++ Sbjct: 15 HGELNPNNEAMFYRSSRILH 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,642,793 Number of Sequences: 5004 Number of extensions: 48829 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -