BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10904 (820 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35417| Best HMM Match : DTHCT (HMM E-Value=1.7) 29 4.5 SB_6205| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_35417| Best HMM Match : DTHCT (HMM E-Value=1.7) Length = 357 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 524 TQSAQDLI-TLEPTEVESSTLAKFVRSVSQQKQISCSDSDPTGQEINSIPIKTESDSL 694 T QDL+ T E + STL K V+ ++K + PT QEI+++ +DSL Sbjct: 97 TSDRQDLMATKEAPKNWRSTLQKQVQVRKEKKNWEIEEKLPTVQEISALLTSDHADSL 154 >SB_6205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 602 VSQQKQISCSDSDPTGQEINSIPIKTESDSLTSLVEKSIKTRAVSENRE 748 + QQKQI C +D + + + TES S+ L + I + + NR+ Sbjct: 81 IEQQKQIICLSADLSSTQEKVEQLPTESYSVNDLKSEIISLKGLLLNRK 129 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,967,576 Number of Sequences: 59808 Number of extensions: 478464 Number of successful extensions: 1436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1432 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -