BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10893 (446 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 38 0.099 UniRef50_UPI0000E815AE Cluster: PREDICTED: similar to glucocorti... 36 0.40 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 1.6 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 4.9 UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole... 32 6.5 UniRef50_Q2ADI6 Cluster: Uroporphyrinogen decarboxylase; n=2; Cl... 32 6.5 UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1... 32 6.5 UniRef50_Q57TT5 Cluster: Putative uncharacterized protein; n=1; ... 31 8.6 UniRef50_Q4Q4V4 Cluster: Putative uncharacterized protein; n=3; ... 31 8.6 UniRef50_Q65NQ9 Cluster: Peptidoglycan DL-endopeptidase cwlO pre... 31 8.6 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 37.9 bits (84), Expect = 0.099 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +2 Query: 140 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGN 253 IYGTGGLLTP+VAP+L YYGN Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGN 54 Score = 36.7 bits (81), Expect = 0.23 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = +1 Query: 253 LVAGSIVSQLTAAAMVAPTP 312 +VAGS++SQLT+AAM+APTP Sbjct: 55 VVAGSVISQLTSAAMLAPTP 74 >UniRef50_UPI0000E815AE Cluster: PREDICTED: similar to glucocorticoid-inducible protein; n=1; Gallus gallus|Rep: PREDICTED: similar to glucocorticoid-inducible protein - Gallus gallus Length = 307 Score = 35.9 bits (79), Expect = 0.40 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +3 Query: 174 WLPCSV--SAQRE*RQEAQPLLHKHTTEISGRQHCVTVDCCCHGSPHAMR*C*TSPVLDI 347 WL +V +A+ R+E P L++H +G +C D CC G C T P LD Sbjct: 13 WLLAAVGSAARARTRRELSPGLYEHGVFDAGGSYCQRGDVCCRGRDDG---C-TVPYLDT 68 Query: 348 APGSDLFC 371 DLFC Sbjct: 69 ICYCDLFC 76 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 1.6 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 76 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 189 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 32.3 bits (70), Expect = 4.9 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 55 LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 174 L + R K+KEHG + +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 >UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF3766, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 328 Score = 31.9 bits (69), Expect = 6.5 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 185 AREPLMESTDPQCHILQHRRPRLPLMQLE 99 A +PL T+P+ +LQ+RRP+L L L+ Sbjct: 5 AEQPLSLRTEPKLRVLQYRRPKLELQLLK 33 >UniRef50_Q2ADI6 Cluster: Uroporphyrinogen decarboxylase; n=2; Clostridia|Rep: Uroporphyrinogen decarboxylase - Halothermothrix orenii H 168 Length = 448 Score = 31.9 bits (69), Expect = 6.5 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -2 Query: 262 RPLISVVCLCSSGCASCRYSR*AETEHGSH*WSQQTPSAIYYSTADRV 119 +PLI V L S CA+C Y + A E G H + Y+T + + Sbjct: 361 KPLIEVFTLDSDTCAACTYMKAAAVEAGKHFGDKVEVVEYKYTTPENI 408 >UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1; n=2; Caenorhabditis|Rep: Laminin related. see also lmb-protein 1 - Caenorhabditis elegans Length = 1067 Score = 31.9 bits (69), Expect = 6.5 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 103 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 207 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >UniRef50_Q57TT5 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 394 Score = 31.5 bits (68), Expect = 8.6 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +1 Query: 88 EHGASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKLVA 261 E S ++G C N+ WG DS G ARF + G+ + R C +L+A Sbjct: 323 EPSPHSYVTGVDASECSNLGEWGEDDS-DGGAARF-VVGSKSSQMCRMCRECCGRLIA 378 >UniRef50_Q4Q4V4 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania major Length = 673 Score = 31.5 bits (68), Expect = 8.6 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 202 GNSGRKHSRCCTSILRKLVAGSIVSQLTAAAMVAPTP*GDAKHHPFSTSLQ 354 G G K +C T + L A +++ ++A A APT G A H L+ Sbjct: 569 GERGAKQVQCFTGTMHLLYATTVILTVSAQAGTAPTASGPAAHEALRAILR 619 >UniRef50_Q65NQ9 Cluster: Peptidoglycan DL-endopeptidase cwlO precursor; n=1; Bacillus licheniformis ATCC 14580|Rep: Peptidoglycan DL-endopeptidase cwlO precursor - Bacillus licheniformis (strain DSM 13 / ATCC 14580) Length = 452 Score = 31.5 bits (68), Expect = 8.6 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 3/74 (4%) Frame = +1 Query: 64 ARREQKLKEHGASSCISGKRGRRCCNIWH---WGSVDSISGSRARFQLSGNSGRKHSRCC 234 A EQKLKE A++ + K S S SGS ++ S NSG S+ Sbjct: 245 AALEQKLKEERAAAAAAAKAKEESATAEKSDSGSSSSSNSGSVSKSDGSSNSGSSSSKKS 304 Query: 235 TSILRKLVAGSIVS 276 +S R +GS+VS Sbjct: 305 SSPSRNYSSGSVVS 318 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,343,984 Number of Sequences: 1657284 Number of extensions: 7646213 Number of successful extensions: 18597 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18536 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 23183027945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -