SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV10893
         (446 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   4.9  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   6.5  
AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    22   8.6  
AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subu...    22   8.6  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   8.6  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 4.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -3

Query: 186  STGATNGVNRPP 151
            STG++N  NRPP
Sbjct: 1627 STGSSNSCNRPP 1638


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 6.5
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = +1

Query: 133 CCNIWHWGSVDS 168
           CC +W W  ++S
Sbjct: 88  CCRLWRWPDLNS 99


>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 22.2 bits (45), Expect = 8.6
 Identities = 13/39 (33%), Positives = 16/39 (41%)
 Frame = +1

Query: 196 LSGNSGRKHSRCCTSILRKLVAGSIVSQLTAAAMVAPTP 312
           LS N        C S+ R +   S  S L+    VAP P
Sbjct: 853 LSHNKVSSLHGSCDSLSRNVSQASSTSDLSKTISVAPDP 891


>AJ292755-1|CAC00630.1|  837|Anopheles gambiae integrin beta subunit
           protein.
          Length = 837

 Score = 22.2 bits (45), Expect = 8.6
 Identities = 9/20 (45%), Positives = 10/20 (50%)
 Frame = +3

Query: 249 EISGRQHCVTVDCCCHGSPH 308
           E SGR  CV   C C   P+
Sbjct: 559 ECSGRGQCVCGVCVCERRPN 578


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 8.6
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 372 NRKGPILERCRE 337
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 448,079
Number of Sequences: 2352
Number of extensions: 8691
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 37843779
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -