BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10880X (353 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 26 0.099 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 1.2 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 20 6.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 8.6 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 20 8.6 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 26.2 bits (55), Expect = 0.099 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +1 Query: 91 ELEHLLAHSDARIKLIVTDGVFSMDGTVAPIKGLRDLADKYRALLVVDDSHATG--FSGK 264 E+E L A + T G ++ G PI+ + D+ KY+ L VD + G S K Sbjct: 274 EIERSLREGAAPFMVSATAGT-TVIGAFDPIEKIADVCQKYKLWLHVDAAWGGGALVSAK 332 Query: 265 LAEALKSI 288 LK I Sbjct: 333 HRHLLKGI 340 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.6 bits (46), Expect = 1.2 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 67 RYPHRDLTELEHLLAHSDARIKLIVTDGVFSMDGTVAPIKGLRDLADKYRALLVV 231 R+ L++L + ++D L+VTD D P +GL L D R L V Sbjct: 179 RHGLETLSQLMDVYPNNDGTKCLVVTDEASISDAPFFPHRGL--LLDTARNFLTV 231 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.2 bits (40), Expect = 6.5 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 238 CHQLLIKLCIYPPDPSDLLLEPQ 170 C++LL L I+P ++ LL + Sbjct: 324 CYKLLSNLGIFPKTTNEQLLRKE 346 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.8 bits (39), Expect = 8.6 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 254 KPVAWLSSTTNKALYLSARSLR 189 KP W SSTT + + + R Sbjct: 1038 KPSTWWSSTTTSPWWTTTTTRR 1059 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/21 (28%), Positives = 13/21 (61%) Frame = +3 Query: 15 EPRVHNRRDQAMQGAEIPIPS 77 +P + +DQ M ++P+P+ Sbjct: 235 DPEDDDDKDQDMDEGDLPLPA 255 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,972 Number of Sequences: 336 Number of extensions: 1529 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7087595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -