BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10880X (353 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 25 1.1 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 25 1.1 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 1.9 AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 23 3.4 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 4.4 AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 23 4.4 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 4.4 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 22 5.9 AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 prot... 22 5.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 5.9 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 299 GGGGYHLFDPGQSSEWSG 352 GGGGY + GQS +SG Sbjct: 29 GGGGYFINGTGQSFNFSG 46 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 299 GGGGYHLFDPGQSSEWSG 352 GGGGY + GQS +SG Sbjct: 29 GGGGYFINGTGQSFNFSG 46 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 253 FSGKLAEALKSIAVLWGRRISS 318 F K++ +K I VL GR+ISS Sbjct: 212 FEQKVSTMIKIILVLMGRKISS 233 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.0 bits (47), Expect = 3.4 Identities = 12/48 (25%), Positives = 25/48 (52%) Frame = -1 Query: 170 VPSIENTPSVTISLILASLCANKCSNSVKSL*GYRYFCALHSLIPSIM 27 +P E+T + +S C+ K NS++ L + ++S IP+++ Sbjct: 56 LPKYEHTHVMQLSTSAIPCCSPKKMNSIRLLYFDMSYNVIYSTIPNMV 103 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 130 VKFYTDDGVWDMVGNNTPIFFIRD 153 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 16 NHASIIDGIRLCKAQKYRYPHRDLTE 93 + A+ ++G+RL + + PHR L + Sbjct: 35 SEATTLEGLRLFMSNTFGIPHRALKD 60 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 127 IKLIVTDGVFSMDGTVAPIKGLRD 198 +K DGV+ M G PI +RD Sbjct: 114 VKFYTDDGVWDMVGNNTPIFFIRD 137 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 22.2 bits (45), Expect = 5.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 296 YGGGGYHL 319 YGGGG+HL Sbjct: 702 YGGGGHHL 709 >AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 protein. Length = 250 Score = 22.2 bits (45), Expect = 5.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 50 HSLIPSIMDAWFKA 9 HSL+P+ ++ W KA Sbjct: 141 HSLLPTAVERWSKA 154 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 5.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 119 SLCANKCSNSVKSL*GYRYFCALHSLIPSIM 27 +LC S S +S GY+ L +++P M Sbjct: 2380 TLCVMVVSYSAESTRGYQMLIILEAILPCYM 2410 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 373,256 Number of Sequences: 2352 Number of extensions: 6718 Number of successful extensions: 28 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 25794900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -