BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10879X (433 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 36 8e-04 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 32 0.008 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 2.7 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 4.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.5 bits (78), Expect = 8e-04 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 254 EIVDLVLDRIRKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 400 E+VD VLD +RK + C LQGF + H LL+ ++ +Y Sbjct: 7 ELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 55 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.5 bits (78), Expect = 8e-04 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 254 EIVDLVLDRIRKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 400 E+VD VLD +RK + C LQGF + H LL+ ++ +Y Sbjct: 7 ELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 55 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.5 bits (78), Expect = 8e-04 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 254 EIVDLVLDRIRKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 400 E+VD VLD +RK + C LQGF + H LL+ ++ +Y Sbjct: 7 ELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 55 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 35.5 bits (78), Expect = 8e-04 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 254 EIVDLVLDRIRKLADQCTGLQGFLIFHXXXXXXXXXXXXLLMERLSVDY 400 E+VD VLD +RK + C LQGF + H LL+ ++ +Y Sbjct: 7 ELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY 55 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 32.3 bits (70), Expect = 0.008 Identities = 22/58 (37%), Positives = 24/58 (41%) Frame = +1 Query: 4 ASSLMARCPQTRPSGVETILSTLSSARPELASTYPVXXXXXXXXXXXXXXXXAHTDSC 177 AS+ RCP+TR S ST SS R AST PV A T SC Sbjct: 29 ASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPARTASC 86 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 2.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 25 CPQTRPSGVETILSTLSSARPELAS 99 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 4.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 47 GWRRFFQHFLQRDRSWQAR 103 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,898 Number of Sequences: 2352 Number of extensions: 8653 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -