BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10869 (391 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70... 77 4e-15 At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS... 73 9e-14 At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS... 72 2e-13 At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS... 71 2e-13 At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70... 71 4e-13 At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta... 68 3e-12 At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)... 62 2e-10 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 62 2e-10 At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)... 62 2e-10 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 56 6e-09 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 0.27 At5g01570.1 68418.m00072 hypothetical protein hypothetical prote... 30 0.63 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 1.5 At1g79930.1 68414.m09340 heat shock protein, putative contains P... 28 2.6 At5g60030.1 68418.m07527 expressed protein 27 3.4 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 27 3.4 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 27 4.5 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 27 5.9 At3g50180.1 68416.m05486 hypothetical protein 27 5.9 At3g25680.1 68416.m03196 expressed protein 26 7.8 At1g11730.1 68414.m01346 galactosyltransferase family protein co... 26 7.8 >At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70, putative similar to heat shock protein hsp70 GI:1771478 from [Pisum sativum] Length = 646 Score = 77.0 bits (181), Expect = 4e-15 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 +DEKL +K++ DKQ I ++TI+W++ NQLA+ +E+E+K KELEGI NPII+KMYQ Sbjct: 559 KDEKLAQKLTQEDKQKIEKAIDETIEWIEGNQLAEVDEFEYKLKELEGICNPIISKMYQ 617 >At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis thaliana} Length = 651 Score = 72.5 bits (170), Expect = 9e-14 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 +DEK+ EK+ +DK+ I D I+WL+ NQLA+ +E+E K KELE I NPII KMYQ Sbjct: 560 QDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQ 618 >At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis thaliana} Length = 653 Score = 71.7 bits (168), Expect = 2e-13 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +2 Query: 5 DEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 DEK+ EK+ +DK+ + D + I+WLD NQL + +E+E K KELE + NPII KMYQ Sbjct: 561 DEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIAKMYQ 618 >At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis thaliana} Length = 649 Score = 71.3 bits (167), Expect = 2e-13 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = +2 Query: 5 DEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 DEK+ EK++ DK+ I D I+WL++NQLA+ +E+E K KELE I NPII KMYQ Sbjct: 561 DEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPIIAKMYQ 618 >At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70, putative strong similarity to heat shock protein GI:425194 [Spinacia oleracea] Length = 650 Score = 70.5 bits (165), Expect = 4e-13 Identities = 30/59 (50%), Positives = 42/59 (71%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 +DEK+ K+ +DK+ I D + I+WLD NQLA+ +E+E K KELE + NPII +MYQ Sbjct: 560 KDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQ 618 >At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, putative / HSC70, putative / HSP70, putative strong similarity to heat shock cognate 70 kd protein 1 SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)] Length = 617 Score = 67.7 bits (158), Expect = 3e-12 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 20 EKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 EK+ +DK+ D + I+WLD NQLA+ +E+EHK KELE +++ IITKMYQ Sbjct: 564 EKLPAADKKKFEDSIEEVIQWLDDNQLAEADEFEHKMKELESVWSTIITKMYQ 616 >At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 613 Score = 61.7 bits (143), Expect = 2e-10 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 + +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K KE+E + NPIIT +YQ Sbjct: 531 DKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQ 589 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 61.7 bits (143), Expect = 2e-10 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 + +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K KE+E + NPIIT +YQ Sbjct: 586 DKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQ 644 >At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1) SWISS-PROT:Q9LKR3 PMID:8888624 Length = 669 Score = 61.7 bits (143), Expect = 2e-10 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 + +KL +K+ +K+ I + ++WLD NQ ++KEEY+ K KE+E + NPIIT +YQ Sbjct: 586 DKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQ 644 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 56.4 bits (130), Expect = 6e-09 Identities = 23/59 (38%), Positives = 40/59 (67%) Frame = +2 Query: 2 EDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 + EKL +KISD DK+ + + ++WL+ N A+KE+Y+ K KE+E + +P+I +Y+ Sbjct: 600 DKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKLKEVELVCDPVIKSVYE 658 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.1 bits (67), Expect = 0.27 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = +2 Query: 14 LKEKI--SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPII 163 LKEK+ S +D T+L++C ++W D +Q K++ E +KELE + +I Sbjct: 252 LKEKLRKSAADLTTVLERCLHRLEW-DRSQEQQKKK-EEDEKELERVQMAMI 301 >At5g01570.1 68418.m00072 hypothetical protein hypothetical protein T16O11.19 - Arabidopsis thaliana, EMBL:AC010871 Length = 157 Score = 29.9 bits (64), Expect = 0.63 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +2 Query: 5 DEKLKEKISDS--DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELE 142 DE KE I +S D Q LD C + +S ++AD+EE E QKEL+ Sbjct: 46 DEDFKE-IHESLQDLQKKLDVCKEKTDEANS-EIADEEEIERLQKELD 91 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 14 LKEKISDS--DKQTILDKCNDTIKWLDSNQLADKEEYEHKQKE 136 LKEK+ S D T+L++C + ++W + +E + K+KE Sbjct: 243 LKEKLRKSVADLTTVLERCLNRLEWDRFQEEEKNKEEDEKEKE 285 >At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam profile: PF00012 Heat shock hsp70 proteins; similar to heat-shock proteins GB:CAA94389, GB:AAD55461 [Arabidopsis thaliana] Length = 831 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 8 EKLKEKISDSDKQTILDKCNDTIKWL-DSNQLADKEEYEHKQKELEGIYNPI 160 +K +E I+DS+++ L + WL + + K Y K +EL+ + +P+ Sbjct: 639 DKYQEYITDSEREAFLANLQEVEDWLYEDGEDETKGVYVAKLEELKKVGDPV 690 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 3.4 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 5 DEKLKEKISDSDKQTILD--KCNDTIKWLDSNQLADKEEYEHKQKELE 142 DEK+KEK+ D K K + K D + + +KE+ E +QK E Sbjct: 166 DEKVKEKLEDEQKSADRKERKKKKSKKNNDEDVVDEKEKLEDEQKSAE 213 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 80 WLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 178 +L SNQ + + ++EH K L+ Y P + +Y+ Sbjct: 402 YLSSNQKSIEWDHEHVYKFLKNYYGPKLVSLYK 434 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.1 bits (57), Expect = 4.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 35 SDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGI 148 +D++T + + ++ I L+ + A EY HK KELE + Sbjct: 2336 ADQKTEITQLSEHISELNLHAEAQASEYMHKFKELEAM 2373 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 26.6 bits (56), Expect = 5.9 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +2 Query: 2 EDEKLKEKISDSD-KQTILDKCNDTIKW-LDSNQLADKEEYEHKQKEL 139 E+EK KEK+ + D K+ + ++ + +K + ++ ++E E K+KE+ Sbjct: 349 EEEKEKEKVKEDDQKEKVEEEEKEKVKGDEEKEKVKEEESAEGKKKEV 396 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 26.6 bits (56), Expect = 5.9 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 266 PAPPPR-GRHLRLRVLRPGSPAYLR 195 P PPPR G LRLR+L P LR Sbjct: 38 PPPPPRLGPRLRLRLLPPPRQQLLR 62 >At3g25680.1 68416.m03196 expressed protein Length = 558 Score = 26.2 bits (55), Expect = 7.8 Identities = 12/55 (21%), Positives = 30/55 (54%) Frame = +2 Query: 8 EKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKM 172 E+LKEK + ++ +L+ + I + ++DK Y + +L+ + + + +K+ Sbjct: 453 ERLKEKAAIDCQKQLLNSLTEEIDEMSQRLISDKSVYLTEHSKLQEMLSDLQSKL 507 >At1g11730.1 68414.m01346 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 384 Score = 26.2 bits (55), Expect = 7.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 11 KLKEKISDSDKQTILDKCNDTIKWLDSN 94 KL SD DK+ +LD N+TI LD + Sbjct: 55 KLSLSSSDCDKKNVLDYGNNTIGILDKS 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,469,601 Number of Sequences: 28952 Number of extensions: 145950 Number of successful extensions: 614 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 557595584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -