BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10864 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1751.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 28 1.7 SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosacc... 27 3.0 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 27 3.9 SPBC839.10 |usp107|snu71|U1 snRNP-associated protein Usp107|Schi... 27 3.9 SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosac... 26 6.9 SPAC22A12.01c |pso2|snm1, SPAC56F8.17c, snm1|DNA 5' exonuclease ... 26 6.9 >SPAC1751.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 123 Score = 27.9 bits (59), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 6/42 (14%) Frame = +3 Query: 141 PTNRI-----ALHTSARYGYEFV-FNEIYNILNMKTYVSDDK 248 PTN++ AL S ++ + F+++ NILN TY DDK Sbjct: 43 PTNKVLSELAALFESCNLIFDLIWFDDLQNILNQVTYELDDK 84 >SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 537 RCKITDEKIHSSRLQCVAKHTYITPSRLSKGEFSLSIER 421 R + EK+ S + + K Y+ PS L+ G+F I + Sbjct: 28 RIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYVIRK 66 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 117 IKQWVDGEPTNRIALHTSARYG-YEFVFNEIYNILNMK 227 I +WVDG+PTN T Y YE F +I+ ++ Sbjct: 71 IDKWVDGDPTNNDFSGTRFEYDIYETEFRNGGDIIGVR 108 >SPBC839.10 |usp107|snu71|U1 snRNP-associated protein Usp107|Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 495 AAERNEFFRQLFYTGQGCRFQGSVYTESGHETMSRL*ANENG 620 A +R E R+L G+G + Y E+G S + +ENG Sbjct: 492 ALDRKEEERELRTRGEGATVETENYVENGKLVTSEMPQHENG 533 >SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosaccharomyces pombe|chr 2|||Manual Length = 1172 Score = 25.8 bits (54), Expect = 6.9 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +3 Query: 21 KINTIYLDTTFQNESFDNFPRRKDSIRMLVNHIKQ---WVDGE 140 +IN L N FD R K +NH+++ W+DG+ Sbjct: 903 EINNGELTIQKLNHEFDRLEREKSVAITAINHLEKENDWIDGQ 945 >SPAC22A12.01c |pso2|snm1, SPAC56F8.17c, snm1|DNA 5' exonuclease |Schizosaccharomyces pombe|chr 1|||Manual Length = 560 Score = 25.8 bits (54), Expect = 6.9 Identities = 17/71 (23%), Positives = 32/71 (45%) Frame = +3 Query: 24 INTIYLDTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNE 203 I+ +YLDTT+ N + FP + D ++ + + + + ++ G E V Sbjct: 320 IHKVYLDTTYLNPKY-TFPPQADVVQACADKAISIKKSTDSRLLVVVSTYSIGKEKVAVA 378 Query: 204 IYNILNMKTYV 236 I L+ + YV Sbjct: 379 IAKSLSSRIYV 389 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,409,674 Number of Sequences: 5004 Number of extensions: 77513 Number of successful extensions: 186 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -