BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10863X (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 2.9 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 8.7 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 2.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 224 PQRLYEKISSKLEEKAPDQVEVFKTNMNKVMKDILG 331 P LYE + + +E QV+ + +N K +LG Sbjct: 261 PSPLYELVDRRNDENIDAQVKYWMSNGAPSAKIVLG 296 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 81 YHPVLSSPTYRSLRK*LHRP 22 YH V P Y S R +++P Sbjct: 46 YHSVKEEPIYESCRFSINQP 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,022 Number of Sequences: 336 Number of extensions: 2327 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -