BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10861 (567 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39930.1 68418.m04842 expressed protein ; expression supporte... 29 1.6 At4g22730.1 68417.m03279 leucine-rich repeat transmembrane prote... 29 1.6 At3g11070.1 68416.m01337 outer membrane OMP85 family protein con... 29 2.9 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 28 5.0 At4g24290.2 68417.m03488 expressed protein 27 6.6 At4g24290.1 68417.m03487 expressed protein 27 6.6 At4g09680.1 68417.m01590 expressed protein 27 8.7 At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / ... 27 8.7 At1g36180.1 68414.m04497 acetyl-CoA carboxylase 2 (ACC2) nearly ... 27 8.7 >At5g39930.1 68418.m04842 expressed protein ; expression supported by MPSS Length = 423 Score = 29.5 bits (63), Expect = 1.6 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 1/99 (1%) Frame = +3 Query: 93 EDYPKIVRSEFDASPDG-AYNYNFETSNGIVRTNTGELKEALDDDNKPHVIVAVREATVT 269 E+ + ++ EF A+ + A +T IVR L A+ N VIV +E + Sbjct: 204 EELARELKEEFSANAESRASGMVIDTMGFIVREGYALLLHAIRTFNASLVIVVGQEEKLV 263 Query: 270 RTLTANLKPLRTSLTRLDTMLRVNLFLRSPPPRAKLLNS 386 L NLK + +L L+ +F RS R L NS Sbjct: 264 YDLKKNLK-FKKNLQVLNLEKSEGVFSRSSDFRKTLRNS 301 >At4g22730.1 68417.m03279 leucine-rich repeat transmembrane protein kinase, putative leucine rich repeat receptor-like kinase, Oryza sativa, PATCHX:E267533 Length = 688 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 306 SLTRLDTM-LRVNLFLRSPPPRAKLLNSLDRFK**SLNTGLCGEDPP 443 ++ +LDT+ LR N PP K LN +F+ NTGLCG D P Sbjct: 210 NIPQLDTLDLRNNTLSGFVPPGLKKLNGSFQFE---NNTGLCGIDFP 253 >At3g11070.1 68416.m01337 outer membrane OMP85 family protein contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 520 Score = 28.7 bits (61), Expect = 2.9 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +3 Query: 216 DDDNKPHVIVA----VREATVTRTLTANLKPLRTSLTRLDTMLRVNLFLRSPPP 365 ++ K H+I A VREAT + L + ++L LD VN+ L S PP Sbjct: 87 NEKTKDHIIEAEVDAVREATTLQELLEASRVANSNLRALDIFDSVNITLDSGPP 140 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/36 (33%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -2 Query: 524 ENTTNIKKNVQKNMAVSIKLITSNKRMWW-IFATQS 420 +N T + +N++K++AVS++ I + ++W + A+QS Sbjct: 5 QNRTTVPENLKKHLAVSVRNIQWSYGIFWSVSASQS 40 >At4g24290.2 68417.m03488 expressed protein Length = 606 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 155 VVVSSIGAGVEFRPNDLRVVLCRGGSDD 72 V + SIG G + DLR+ C+GGS D Sbjct: 13 VAIGSIGCGYDLAI-DLRLKYCKGGSKD 39 >At4g24290.1 68417.m03487 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 155 VVVSSIGAGVEFRPNDLRVVLCRGGSDD 72 V + SIG G + DLR+ C+GGS D Sbjct: 13 VAIGSIGCGYDLAI-DLRLKYCKGGSKD 39 >At4g09680.1 68417.m01590 expressed protein Length = 1075 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/69 (17%), Positives = 32/69 (46%) Frame = -2 Query: 365 WRRRPEE*IHPEHGIQSRQRST*WFQVCRQCSCNCSFTHSNNNVRLVVVVESLLQLTSVR 186 W ++ ++ H I++ + + C SC C+ + N++LV+ + S + V Sbjct: 325 WLLLTDQILNRSHSIRTGSLGGIFTEFCMHESCGCNSEARDCNLKLVMPISSFVHHVKVM 384 Query: 185 THDAVGSLE 159 ++ + ++ Sbjct: 385 LNELLSQIK 393 >At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein ; contains Pfam profiles PF00331: Glycosyl hydrolase family 10, PF02018: Carbohydrate binding domain Length = 752 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +3 Query: 333 RVNLFLRSPPPRAK-LLNSL 389 RV L+L PPPRA LLNSL Sbjct: 154 RVILYLEGPPPRADILLNSL 173 >At1g36180.1 68414.m04497 acetyl-CoA carboxylase 2 (ACC2) nearly identical to acetyl-CoA carboxylase 2 (ACC2) [Arabidopsis thaliana] GI:11869928 Length = 1755 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = +3 Query: 126 DASPDGAYNYNFETSNGIVRTNTGELKEA---LDDDNKPHVIVAVREATVTRTL 278 D G+ Y SN V L++ + D K HVI A EAT TR L Sbjct: 111 DVVRGGSGTYRLRMSNSEVVAEIHTLRDGGLLMQLDGKSHVIYAKEEATGTRLL 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,297,100 Number of Sequences: 28952 Number of extensions: 216410 Number of successful extensions: 667 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -