BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10857 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch... 27 2.2 SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p... 25 9.0 >SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 445 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 753 FYIVPQEGKWIIIEK*SWEQPI*ILDFM*AASSHNKVSK 637 F +P +W I+ SW + + +L F+ + H +VS+ Sbjct: 122 FSQMPSSSQWSIVRNSSWYENLKLLKFLSSVGPHVRVSQ 160 >SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.4 bits (53), Expect = 9.0 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 225 PEFSIFPPTPVGNRH-GLGDGRTFLRY 148 P I P +G R+ GLG G+ F+RY Sbjct: 453 PLIDIKIPRSIGTRNSGLGTGKVFVRY 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,500,820 Number of Sequences: 5004 Number of extensions: 76106 Number of successful extensions: 160 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -