BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10857 (767 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060724-1|AAL28272.1| 694|Drosophila melanogaster GH17145p pro... 30 4.0 AE014296-2824|AAF49397.2| 694|Drosophila melanogaster CG11915-P... 30 4.0 BT010071-1|AAQ22540.1| 1250|Drosophila melanogaster LD11744p pro... 29 9.3 >AY060724-1|AAL28272.1| 694|Drosophila melanogaster GH17145p protein. Length = 694 Score = 29.9 bits (64), Expect = 4.0 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +3 Query: 27 HRIWSKDPAKSYHPIRSSISSAEAAGE----PW---IPDHY 128 HR + PAK P S +S E GE PW +P+HY Sbjct: 565 HRRHKRSPAKDVRPTAESTTSLEMLGEESTNPWGEVVPEHY 605 >AE014296-2824|AAF49397.2| 694|Drosophila melanogaster CG11915-PA protein. Length = 694 Score = 29.9 bits (64), Expect = 4.0 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +3 Query: 27 HRIWSKDPAKSYHPIRSSISSAEAAGE----PW---IPDHY 128 HR + PAK P S +S E GE PW +P+HY Sbjct: 565 HRRHKRSPAKDVRPTAESTTSLEMLGEESTNPWGEVVPEHY 605 >BT010071-1|AAQ22540.1| 1250|Drosophila melanogaster LD11744p protein. Length = 1250 Score = 28.7 bits (61), Expect = 9.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 12 SDCSGHRIWSKDPAKSYHPIRSSISSAEAAGEPWIPDH 125 S CS + + SY P SSI +A+ W+PDH Sbjct: 1131 STCSWEAVEERSGPASYAP--SSIQEKKASSVLWVPDH 1166 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,418,247 Number of Sequences: 53049 Number of extensions: 816928 Number of successful extensions: 1451 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1448 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3540671772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -