BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10847 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 25 0.77 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.4 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 4.1 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 5.4 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 7.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.5 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 25.0 bits (52), Expect = 0.77 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +1 Query: 562 LSKEEIERMVNEAEKYRN---EDEQAKGDHPGQECIGILLLQHEVYH 693 L + ++E ++ EA+ +N +D+ K + G C+ +LL+ +YH Sbjct: 577 LPEVDVEEILGEAKVLQNFDIKDKNKKVNVAGCRCVKGILLKSGLYH 623 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 352 EYSGLVIRVGGECLSLFSGDGSVTLDECGHDTSAVSIPRERG 227 E+ G+ +G ++L SG+ LD GH +A R RG Sbjct: 174 EFGGITQCIGAFDVTLESGERVTFLDTPGH--AAFISMRHRG 213 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 208 SRTHGFQHTSSHYSRERSCSRDRNREY 234 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 507 SEVHQQGEQDHHYQRQRSSLQGRDRAY 587 S H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 327 TLITNPEYSSKYLR 368 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 30 HDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDE 137 +D ++VGG V L + N K L PDE Sbjct: 69 YDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDE 104 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 612 SVLLCLINHTLDLFLG 565 SVL+CL+N T +G Sbjct: 10 SVLICLLNETAKAIIG 25 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/22 (27%), Positives = 16/22 (72%) Frame = +2 Query: 572 KRSSVWLMRQRSTETRMNKQKE 637 ++S +W+ + +++E NK+K+ Sbjct: 194 EKSELWVYKSKASEEHGNKKKK 215 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 444 PRGAGGIPVS 415 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 282 VTLPSPLNRLRHSPP 326 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,003 Number of Sequences: 438 Number of extensions: 3834 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -