BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10846 (439 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 37 0.16 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 37 0.22 UniRef50_Q01TS6 Cluster: Transposase IS66; n=1; Solibacter usita... 31 8.1 UniRef50_Q23E28 Cluster: Patched family protein; n=1; Tetrahymen... 31 8.1 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 37.1 bits (82), Expect = 0.16 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 427 FLLLRWVDELTAHLVL 380 FLLLRWVDELTAHLVL Sbjct: 154 FLLLRWVDELTAHLVL 169 Score = 31.9 bits (69), Expect = 6.2 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 365 PMDIYNVNAPPTLRYKF 315 P +Y+VNAPPT RYKF Sbjct: 175 PRHLYDVNAPPTSRYKF 191 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 36.7 bits (81), Expect = 0.22 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 230 WYLPARTHKRSYHQ 189 WYLPARTHKRSYH+ Sbjct: 572 WYLPARTHKRSYHR 585 >UniRef50_Q01TS6 Cluster: Transposase IS66; n=1; Solibacter usitatus Ellin6076|Rep: Transposase IS66 - Solibacter usitatus (strain Ellin6076) Length = 963 Score = 31.5 bits (68), Expect = 8.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 306 QYSYNGCRTLPTETHLLLTAEIGSAVVPTRADSQEVLPPVITQI 175 +Y+ C L T T + +A GSA PT + + LPP++ ++ Sbjct: 441 EYNLEDCAALRTVTEFVKSA-CGSASAPTESGKADALPPMVMRV 483 >UniRef50_Q23E28 Cluster: Patched family protein; n=1; Tetrahymena thermophila SB210|Rep: Patched family protein - Tetrahymena thermophila SB210 Length = 1207 Score = 31.5 bits (68), Expect = 8.1 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -1 Query: 154 FITRCYSFTVEVNRKYLLST*FIRK 80 FI RCYS TV +++KY+L + ++ K Sbjct: 434 FIIRCYSITVALDKKYILESSYLCK 458 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,101,156 Number of Sequences: 1657284 Number of extensions: 9533294 Number of successful extensions: 20811 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20793 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 21918499148 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -