BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10846 (439 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 29 0.096 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 26 0.67 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.2 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.2 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 2.1 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 2.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 4.8 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 22 8.3 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 28.7 bits (61), Expect = 0.096 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 74 TNFSNELRTQQIFTIDFHGEGITSCNKSETRKIIICVITG 193 + + + QQ +I H EG+ + RK ++C ITG Sbjct: 109 SELAGQQEPQQALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 25.8 bits (54), Expect = 0.67 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 274 NRNAFTAHGRNRQCGGTYPRGLTRGPTTSNYANYNFAGF 158 + + ++ G+ Q GG YPRG R + Y + G+ Sbjct: 245 DNDGYSRGGQYDQRGGNYPRGTERNRNGNGYGAGDDGGY 283 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.2 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 74 TNFSNELRTQQIFTIDFHGEGITSCNKSETRKIIICVITGGRTSCESA 217 T+FS+ T + D +G+G TS S I + G ++ SA Sbjct: 618 TSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTVLAEGDKSVSASA 665 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.0 bits (52), Expect = 1.2 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 74 TNFSNELRTQQIFTIDFHGEGITSCNKSETRKIIICVITGGRTSCESA 217 T+FS+ T + D +G+G TS S I + G ++ SA Sbjct: 619 TSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTVLAEGDKSVSASA 666 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.2 bits (50), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 56 RIPQAGTNFSNELRTQQIFTIDFHGEG 136 R AGT F + +++ F HGEG Sbjct: 286 RFQHAGTRFKTKQFSKENFLATLHGEG 312 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 2.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 264 HLLLTAEIGSAVVPTRADSQEVLP 193 H+ AEIG ++V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 4.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -2 Query: 369 GAHGHLQRKCATHVEI*VLRSQYSYNGCRTLPTETHLLLTAEIGSA 232 G+H L + +++ +LR + + P ETH L IGSA Sbjct: 1768 GSHSKLYSQINI-IKLPILRKDRLIHSTPSSPQETHKLSAEVIGSA 1812 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 18 GANISDEEIKEEVDTIMFEGHDTTAAGSS 46 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 18 GANISDEEIKEEVDTIMFEGHDTTAAGSS 46 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 15 GANISDEEIKEEVDTIMFEGHDTTAAGSS 43 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 29 GANISDEEIKEEVDTIMFEGHDTTAAGSS 57 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 14 GANISDEEIKEEVDTIMFEGHDTTAAGSS 42 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 14 GANISDEEIKEEVDTIMFEGHDTTAAGSS 42 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 27 GANISDEEIKEEVDTIMFEGHDTTAAGSS 55 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 28 GANISDEEIKEEVDTIMFEGHDTTAAGSS 56 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 28 GANISDEEIKEEVDTIMFEGHDTTAAGSS 56 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 71 GTNFSNELRTQQIFTIDFHGEGITSCNKS 157 G N S+E +++ TI F G T+ S Sbjct: 26 GANISDEEIKEEVDTIMFEGHDTTAAGSS 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 513,504 Number of Sequences: 2352 Number of extensions: 10041 Number of successful extensions: 66 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -