BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10844 (790 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 2.1 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 2.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.7 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 22 4.9 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 6.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.4 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.5 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 207 HTLKGECRHMLLHHWPFSLNP 269 HT + +C H LL H P +P Sbjct: 352 HTPEPDCIHELLGHMPLLADP 372 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 506 CELHSVALRCNAKT 547 CELH++ L CN T Sbjct: 117 CELHTIFLVCNVLT 130 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 155 EQRADWLHLAKTRVNTPRKLPQPW 84 ++ A +H R+ P+K+P P+ Sbjct: 645 DEAASDVHQTHMRIRPPKKIPTPY 668 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 155 EQRADWLHLAKTRVNTPRKLPQPW 84 ++ A +H R+ P+K+P P+ Sbjct: 645 DEAASDVHQTHMRIRPPKKIPTPY 668 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 155 EQRADWLHLAKTRVNTPRKLPQPW 84 ++ A +H R+ P+K+P P+ Sbjct: 645 DEAASDVHQTHMRIRPPKKIPTPY 668 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 155 EQRADWLHLAKTRVNTPRKLPQPW 84 ++ A +H R+ P+K+P P+ Sbjct: 645 DEAASDVHQTHMRIRPPKKIPTPY 668 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 527 LRCNAKTPRLFTVLC 571 L C+ P LF+VLC Sbjct: 65 LNCHRMKPALFSVLC 79 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +1 Query: 502 CL*TSFCRSSLQRKNTTFIHST 567 C T R+ + NT+ IHST Sbjct: 181 CSYTVLIRNKISNLNTSLIHST 202 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = -3 Query: 449 HIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRGHYKGQQVGKVMQVYR 294 HI R + S + ++ KS+P+RK E++ + +K ++ R Sbjct: 576 HIMRSITESGGRRRQTREKRKKSLPVRKLLELERAQHEFKNGDSSSLLDKMR 627 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 8.5 Identities = 6/28 (21%), Positives = 17/28 (60%) Frame = -3 Query: 332 KGQQVGKVMQVYRKKFVVYIERIQRERP 249 +G +V K+ ++Y + Y++ ++ +P Sbjct: 473 EGWKVEKIQEIYLEALRAYVDNRRKPKP 500 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,752 Number of Sequences: 336 Number of extensions: 4434 Number of successful extensions: 18 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -