BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV10844 (790 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 27 0.87 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 2.0 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 2.0 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 2.0 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 2.0 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 2.0 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 25 2.7 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 4.7 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 24 6.2 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 6.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 8.1 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 26.6 bits (56), Expect = 0.87 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 342 TYNLNFIVFANRHGFYIEFLS*FLRQGRGHQHSPY 446 T+ L ++FA R+ F + S +++GR H PY Sbjct: 27 TFGLTRLLFAGRNPFGSDLASLNIQRGRDHALRPY 61 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 70 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 189 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 70 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 189 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 70 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 189 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 70 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 189 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 70 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 189 C G C SF G F Q ALCS+ EDC +H Sbjct: 618 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 657 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 25.0 bits (52), Expect = 2.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 417 QGRGHQHSPYM*RSTEMPLPVFPS*G 494 Q GH HS +S +P+PVF G Sbjct: 150 QAAGHLHSSVSEKSKTVPVPVFQKVG 175 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 388 TLNFCLSSLDRGEDINTRL 444 T+NFCL L + DI RL Sbjct: 319 TMNFCLYELAKNPDIQGRL 337 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 23.8 bits (49), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 610 RDMFFEPFHCIL 645 RD+FFEP+ C L Sbjct: 31 RDIFFEPYRCQL 42 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 388 TLNFCLSSLDRGEDINTRL 444 T+NFCL L + DI RL Sbjct: 320 TMNFCLYELAKHPDIQERL 338 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -1 Query: 244 CNSICRHSPFKVCDCQVE 191 C ++C F CDC++E Sbjct: 740 CFALCHCCDFYACDCKME 757 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,823 Number of Sequences: 2352 Number of extensions: 18096 Number of successful extensions: 35 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -